KEGG   Bacillus velezensis UCMB5113: BASU_1041Help
Entry
BASU_1041         CDS       T02796                                 

Gene name
samT
Definition
(GenBank) homocysteine S-methyltransferase using (R,S)AdoMet and methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn00270  Cysteine and methionine metabolism
bamn00670  One carbon pool by folate
bamn01100  Metabolic pathways
bamn01110  Biosynthesis of secondary metabolites
bamn01120  Microbial metabolism in diverse environments
bamn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BASU_1041 (samT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BASU_1041 (samT)
Enzymes [BR:bamn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BASU_1041 (samT)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     BASU_1041 (samT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR ExbD
Motif
Other DBs
NCBI-ProteinID: CDG25339
Position
complement(1069132..1070973)
Genome map
AA seq 613 aa AA seqDB search
MGLLQDLKERILIGDGAMGTLLYSYGIDRCFEELNVSKPEEIKRIHKAYVEAGADIIQTN
TYGANFIKLSRYGLEDETKKINQEAVRIARASSDGAYVLGTMGGIRTFNKNAYSLEEIKR
SFREQLYLLLHEEPDGLLLETYYDLEEAREVLKIARKETELPIMLNVSMHEQGVLQDGTP
LREALRSIADLGADITGINCRLGPYHMIEALTEVPIFSDAYLSVYPNSSLPSLEEGRLVY
DTDDAYFRESAVQFRTQGARIIGGCCGTTPNHIRAMAEAVRGLSPVTEKEVKIRREEEVI
SVSNERIEPGLNEIAAQKRSIIVELDPPKKLNFDKFLQAAAELKETGIEALTLADNSLAT
PRISNAACGSLLKERLDIRSLVHITCRDRNIIGLQSHLMGLDTLGLTDILAITGDPSKIG
DFPGATSVYDLTSFDLIRLIKQFNEGISLSGKPLGKKTNFSVAGAFNPNVRHLDKAVKRL
EKKIECGADYFVSQPVYSEQQLIDIHHETKHLKTPVYIGIMPLTSSRNAEFIHHEIPGIK
LSDSIREKMALAGEDKRKQKAEGLAIAKSLLDTACELFNGIYLITPFLRSDLTSELAAYI
KQKDEKRADVYLH
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgggactattacaagacttaaaagaacggattttaatcggagacggcgcgatgggcact
ctcctctattcctacggcattgacagatgttttgaggaactgaacgtatcaaagcccgaa
gagatcaagcggatacataaggcttacgtggaagccggggcagacatcatccagacaaat
acgtacggcgcgaattttattaagctctcaagatacggacttgaggacgaaacgaaaaaa
atcaatcaggaggcggtcagaatcgcgcgcgcttcctcagacggcgcttatgtattggga
acgatgggcggcatccgcacctttaacaaaaacgcctacagcctggaggagattaaacgc
agctttcgggagcagctttatttattgctgcacgaagagccggacggtctgcttctggaa
acatactatgatttagaagaggcgcgcgaagtgctgaagatcgcgagaaaagaaacggaa
cttccgattatgctgaacgtatccatgcacgaacagggcgtgctgcaggacggaacgccg
cttcgggaagccctcaggtcaattgccgatctcggcgctgacataacgggaatcaattgc
cggctcggcccgtaccacatgattgaagcgctcaccgaagtgccgattttcagtgacgct
tatttatcggtctatccgaacagcagccttccgtctttagaagaaggccggcttgtttat
gatacggacgatgcctatttccgggagagcgccgtacagttccgcactcagggcgcgcgc
attatcggcggctgctgcggtacgacgccaaaccatatcagagccatggctgaagcggtc
cgcggcctttcccccgtcactgagaaagaagtgaaaatcagacgggaagaagaagtcatc
tcagtcagcaacgaacgaatcgaaccgggtttaaacgaaatcgccgctcaaaaacggtca
attatcgtagagcttgatccgccgaaaaaattgaattttgacaaatttctgcaagcggcg
gctgaattaaaagaaaccggcatagaagcgctgacgctcgccgacaattcattggcgaca
ccgcggatcagcaatgcagcctgcggttcattgctgaaagagcgccttgatatccgttct
ctcgttcacattacatgcagagaccgcaacatcatcggccttcagtcacatttaatgggg
ctggatacgctcgggctcaccgacattttagccatcacgggtgatccttcaaaaatcggc
gactttccaggggctacctccgtctatgatttaacgtcctttgacttgatcaggctgatt
aaacaattcaacgagggcatttctttatcagggaaaccgctcggcaagaaaacgaacttt
tccgtagccggagcatttaatccgaatgtccgccatctcgataaagcagtaaaacggctg
gagaaaaaaatcgagtgcggagctgactacttcgtgtcccagcctgtctactcggagcag
cagctcattgacattcatcatgaaacgaagcatctcaaaacaccggtgtatatcggaatc
atgccgttaacgagcagccgcaacgcagagttcatccatcatgaaatcccgggcattaag
ctgtcagacagcatccgcgaaaaaatggcgctcgccggcgaagacaagcggaagcagaaa
gccgaaggcctcgccatcgccaagtcgcttctcgacacggcgtgcgaactgtttaacgga
atttatttaatcaccccgtttctccgttctgatttgacgtcagagcttgcagcttatatt
aagcaaaaggatgaaaagcgggctgatgtatatttgcattga

DBGET integrated database retrieval system