KEGG   Bacillus velezensis UCMB5113: BASU_1064Help
Entry
BASU_1064         CDS       T02796                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn00220  Arginine biosynthesis
bamn01100  Metabolic pathways
bamn01110  Biosynthesis of secondary metabolites
bamn01130  Biosynthesis of antibiotics
bamn01230  Biosynthesis of amino acids
Module
bamn_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BASU_1064 (argF)
Enzymes [BR:bamn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BASU_1064 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: CDG25362
Position
1093467..1094438
Genome map
AA seq 323 aa AA seqDB search
MHTIKAEHTLTHLYGKDFLSLKDVSPSDIKALLTEASLLKQHPIQPIFQGKTLAMIFEKS
STRTRVSFEAGMAQLGGTGLFLSSSDLQLGRGETVADTAKVLSGFVDAIMIRTFEHEKVE
ELAEHADIPVINGLTDRYHPCQALADLLTIQEIKGKLKGVKAAYIGDGNNVAHSLMIGCA
KMGCDIAIASPKGYEVEEEAVNAAKEAAAVSGAKITLTENPQEAVRDADVIYSDVFTSMG
QEEETQQRLNVFAPYQVNASLVSLAKPDYTFLHCLPAHREEEVTSEIIDGPNSAVFQQAE
NRLHAQKALLKALLYKQDEQKNR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaataaaagcggaacacacattaacccatttgtacggcaaagattttctttcc
ttaaaagatgtcagcccgtcagacatcaaagcgcttctgacagaagcttcattattaaaa
caacatccgatacagccgattttccaagggaaaacattggcgatgatttttgaaaaatct
tcaacccgcacacgtgtgtcttttgaagcgggaatggcccagctcgggggaacgggacta
tttctttcaagcagcgacctgcagcttgggcggggggagacggtcgcggatacggcgaag
gtgctgtccggcttcgttgatgccattatgatccgcacctttgagcatgaaaaagtcgaa
gagcttgccgagcatgcagacattcccgtcataaacgggctgaccgaccggtatcacccg
tgtcaggcactcgcggatctgttaacgatacaagaaataaaaggaaaactgaaaggagta
aaagccgcctatatcggtgacggaaataatgtggcgcattcacttatgatcggctgcgca
aaaatgggctgtgacattgcgattgcttcgccgaaaggctatgaagtagaggaagaggcg
gtgaatgccgcgaaagaagcggcggctgtttccggagcgaaaatcacccttaccgaaaat
ccgcaggaagcggtgcgggatgcagatgtgatttactccgacgtcttcacgagcatgggg
caggaggaagagacgcagcagcggctgaatgtgtttgccccgtatcaagtcaacgcctca
ctcgtcagtctcgcaaaacccgactatacatttttgcattgcctgcccgcgcatcgggaa
gaagaggtcacgtccgagattatcgacggtccgaactctgcggtatttcagcaggcggaa
aaccggcttcacgcgcaaaaagcgctcctgaaagctcttctttacaaacaggatgaacaa
aaaaaccgctga

DBGET integrated database retrieval system