KEGG   Bacillus velezensis AS43.3: B938_00825Help
Entry
B938_00825        CDS       T02382                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B938_00825
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     B938_00825
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     B938_00825
    1.1.1.-  
     B938_00825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NADH_4Fe-4S ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AFZ89210
Position
180419..181465
Genome map
AA seq 348 aa AA seqDB search
MKALVWTPNDKLEYQEVDEPQIRKSNDVKVKIFGTGICGTDLNVLKGKMNATHHMIMGHE
SVGAVVEIGPDVTNVKVGDRVVIDPTQFCGKCHYCRRGLTCYCETFEDWQLGIGAHGTFA
EYYVGEDRFMYRIPDSMEWERATLVEPLSCVLNVVDKASIQPEDSVLVLGSGPIGLLVQM
MVKKLARLTVATEIGSFRSEAASRISDYVYHPEALTVDEVKRINQGRKFDVIFDAIGNQL
DWAYPFIEKGGRIVPMGFDDTYEMTVRPYQLLSNGVTIVGTGEARQIMEAALACASDLPQ
LYDFITEKTELKNYEEAIDHLMGIDPVTKERKDISAIKTILVSDPELL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttggtctggactcctaatgataagcttgaatatcaagaggtggacgagcct
caaattcggaaatccaatgatgtgaaagtgaaaattttcggcaccggtatctgcggaacg
gacttaaatgtgctgaaaggaaaaatgaatgcaacccatcatatgattatggggcatgaa
tcggtgggagcggtcgtggaaatcggaccggacgtgacaaatgtaaaagtcggagaccgc
gtcgtgatagatcctacgcagttttgcgggaaatgtcattattgccggagagggctgacg
tgttattgcgaaaccttcgaggattggcagctcggaatcggggcgcacggaacgtttgcg
gaatattacgtgggggaagacaggttcatgtacagaattccggattcaatggaatgggag
cgggccacattggttgagcctctctcctgtgtgctgaatgttgtggacaaggcttcgatt
cagccggaggactcggtcttggttttggggtcgggaccgatcggactgcttgtgcaaatg
atggtgaaaaaactggcgcgattgacggttgcgactgaaataggcagtttccgaagcgag
gcggcaagccggatatctgattatgtctaccaccctgaagcgttaaccgtggatgaagtg
aaacggattaatcaaggaagaaaatttgatgtgatttttgacgcaatcggcaatcagctt
gattgggcttatccttttattgaaaagggaggcagaatcgtgccgatgggctttgatgat
acgtatgagatgacggtcaggccgtaccagctgctgtcaaacggcgtaacgattgtgggc
acaggtgaagcccgccagatcatggaagccgcgttagcatgcgcgtccgaccttccgcag
ctctatgattttattacggaaaagacggaactgaagaattatgaagaagccattgatcat
ctcatgggcatcgacccggtgacaaaagaaagaaaggatatcagcgcaataaaaacgatt
cttgtgtctgatccggaacttttataa

DBGET integrated database retrieval system