KEGG   Bacillus velezensis AS43.3: B938_01860Help
Entry
B938_01860        CDS       T02382                                 

Definition
(GenBank) glucose-1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00030  Pentose phosphate pathway
bamp01100  Metabolic pathways
bamp01120  Microbial metabolism in diverse environments
bamp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B938_01860
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     B938_01860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 THF_DHG_CYH_C Epimerase SPOR
Motif
Other DBs
NCBI-ProteinID: AFZ89408
Position
408456..409241
Genome map
AA seq 261 aa AA seqDB search
MYTDLKGKVVAITGASSGLGKAMAIRFGQEQAKVVVNYYSNEKDAQTVKEEIQKAGGEAV
IIQGDVTKEEDVKNIVQTAVKEFGTLDVMINNAGMENPVQSHEMPLKDWNKVINTNLTGA
FLGSREAIKYYVENDIQGNVINMSSVHEMIPWPLFVHYAASKGGIKLMTETLALEYAPKR
IRVNNIGPGAINTPINAEKFADPVQKKDVESMIPMGYIGEPEEIAAVAVWLASKESSYVT
GITLFADGGMTKYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtacacggatttaaaaggaaaagtcgttgccattacgggagcttcatcaggattagga
aaagcgatggcgatccgcttcggacaggagcaggcgaaagtcgtggttaactactatagt
aatgaaaaagacgcccaaaccgttaaagaagagattcaaaaagcgggaggcgaagcggtc
atcattcaaggcgacgtcacaaaagaagaagatgtcaaaaacatcgtgcagaccgcggtg
aaggaattcggcacattggatgtcatgatcaataacgccggtatggaaaatccggttcag
tcgcatgaaatgccgctcaaagactggaacaaagtcattaataccaatctgaccggcgct
ttcttaggaagccgcgaagccattaaatattacgtagagaatgatattcaaggaaacgtc
attaacatgtcaagcgtacatgaaatgattccatggcctctgtttgttcactacgcggcg
agtaaaggcggcatcaaattgatgacggaaacgctggcgctggagtacgcgccgaagcgc
atccgtgtcaacaacatcgggccgggagccatcaatacgccgatcaacgcggaaaaattt
gcggatcccgttcagaaaaaagatgtggaaagcatgattccgatgggatatatcggtgag
ccggaagaaatcgcggctgtcgccgtctggcttgcttcaaaggaatcaagctacgtaacc
ggcattacgctgtttgctgacgggggaatgaccaaatatccgtcattccaggcaggccgc
ggataa

DBGET integrated database retrieval system