KEGG   Bacillus velezensis AS43.3: B938_03045Help
Entry
B938_03045        CDS       T02382                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B938_03045
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     B938_03045
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     B938_03045
    1.1.1.-  
     B938_03045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C PALP F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AFZ89641
Position
complement(624828..625868)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIENIDEPKAEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVGKPHPLT
NEMAPVTMGHEFSGEVVEVGEGVKNYSVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPEELSYEQGALVEPSAVALYAVRQSKLKAGDTAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQEKAKELGAIIIDPSKTDDVVEEIAKRTNGGVDVS
YEVTGVPVVLRQAIQSTNIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPSV
LALMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKNQVKILVKPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcaagatggcacaatcaaaaagacattcgaatcgaaaacattgatgaacct
aaagcagaaccgggtaaagtcaaaattaaagtcaaatggtgcgggatttgcggaagcgac
cttcatgaatatttgggaggcccgatctttattccggtcggcaaacctcatccgttaaca
aacgaaatggcgcccgtcacgatgggtcacgaattctcaggagaagtcgttgaagtgggc
gaaggcgtcaaaaattacagcgtcggcgaccgtgtcgtcgtggaaccgatttttgccaca
cacggacatcagggagcctataaccttgatgaacaaatgggattcttaggcttagctgga
ggcggcggcggattttctgaatatgtatccgttgacgaagaattgctgtttaagcttcct
gaagagctttcttacgaacagggcgcgcttgttgagccgtcagcggtagcgctttacgcc
gtccgccaaagcaaattaaaagcgggcgacacggcggcagtttttggctgcggaccgatc
gggctgcttgtgattgaagccctgaaagcggccggcgccacagatatttacgcggttgaa
ctttcaccggaacgtcaggaaaaagcgaaagaactcggcgctatcatcattgatccgtca
aaaacggacgatgtcgttgaagaaatcgctaaacgtacaaacggaggcgttgatgtttct
tatgaagtaacaggcgttcctgtcgttctccgccaggcgatccagtcaacaaacattgcc
ggtgaaacggttatcgtcagcatttgggaaaaaggagcggaaattcatccgaacgatatc
gttatcaaagaacggaccgtaaaaggcattatcggataccgtgacatcttcccttccgtt
cttgcactgatgaaagagggctacttctcagcagataagctcgtcacgaaaaaaattgtg
ctcgacgatctgattgaagaaggcttcggcgctttaatcaaagagaaaaaccaagtgaaa
atcttagtcaaaccgaactaa

DBGET integrated database retrieval system