KEGG   Bacillus velezensis AS43.3: B938_04245Help
Entry
B938_04245        CDS       T02382                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00860  Porphyrin and chlorophyll metabolism
bamp01100  Metabolic pathways
bamp01110  Biosynthesis of secondary metabolites
bamp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B938_04245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bamp01007]
    B938_04245
Enzymes [BR:bamp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     B938_04245
Amino acid related enzymes [BR:bamp01007]
 Aminotransferase (transaminase)
  Class III
   B938_04245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFZ89877
Position
complement(875197..876486)
Genome map
AA seq 429 aa AA seqDB search
MYTKSVELHKEALEHIVGGVNSPSRSYKAVGGGSPVAMEKANGAYFWDVDGNQYIDYLAA
YGPIITGHAHPHITEAIKTAAENGVLYGTPTKHEVTFAKMLKEAIPSLDKVRFVNSGTEA
VMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVIT
VPFNDIESYKAALDKWGSEIAAVLVEPIVGNFGIVEPEEGFLEQVNELTHKAGALVIYDE
VITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGTM
AGNPASILSGIACLEVLKEEGVYERLDELGARLEQGILAHAETHGITITVNRLKGALTVY
FTDEKIVNYEQAENTDGEAFAKFFKLMLERGINLAPSKYEAWFITTAHTEEDIDATLQAV
EDAFRHMKK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttgtatacaaaatcagttgaacttcataaggaagcgttagagcatatcgtcggaggcgtg
aacagcccgtccagatcctataaagcggtaggcggcggttcacccgttgcgatggaaaaa
gcgaacggcgcttatttctgggatgtagacgggaatcagtatatcgattatttagcggct
tacggcccgattattaccggacatgcccatccgcatataactgaagcgattaaaacagcg
gctgaaaacggcgtgctgtacgggacgccgaccaaacatgaggtcactttcgccaaaatg
ctgaaggaggccattccttcacttgataaagtacgattcgtaaactcgggcactgaagcg
gtaatgacaacgatccgggttgcacgcgcttatacaggccggacaaaaatcattaaattc
gctggctgctatcacggccattctgatcttgtacttgtcgctgcgggttccggtccgtct
acgctcggcactcctgattccgccggcgtgccgaaaagcatcgccaatgaggtgattacc
gttcctttcaatgacattgaaagctacaaagccgcgctggataaatggggttcagaaatt
gcagcggttctcgtcgagccgatcgtcggcaacttcggcatcgttgaacctgaagaagga
tttttagaacaggtaaatgaattgacccataaagcgggcgcgctcgtcatttatgatgaa
gtgatcacggcgttccgttttatgtatggaggcgcgcaggatcttcttcaagtgaagcct
gatttaacggcgctcggtaaaattatcgggggcggcttgccgatcggcgcttacggaggc
aaaaaagagatcatggagcaggttgctccgctcggcccggcatatcaagccggcacaatg
gccggaaacccggcatctatcctatcaggcatcgcctgcctggaagtgctgaaggaagaa
ggcgtttatgagcggcttgatgagctcggcgccagacttgagcaaggcattctcgcccat
gcggagacacacggcattaccatcaccgtcaaccgtttaaaaggcgcgctcacggtttac
ttcactgatgaaaagatcgtcaattacgagcaggcggaaaatacggacggagaagcattc
gccaagttcttcaagctgatgcttgagcgcggcatcaatctcgctccatcgaagtatgaa
gcttggtttatcacaaccgcacatactgaagaggatatcgacgccactttacaggccgtt
gaagatgcgttcagacatatgaaaaaataa

DBGET integrated database retrieval system