KEGG   Bacillus velezensis AS43.3: B938_05080Help
Entry
B938_05080        CDS       T02382                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00071  Fatty acid degradation
bamp00072  Synthesis and degradation of ketone bodies
bamp00280  Valine, leucine and isoleucine degradation
bamp00310  Lysine degradation
bamp00362  Benzoate degradation
bamp00380  Tryptophan metabolism
bamp00620  Pyruvate metabolism
bamp00630  Glyoxylate and dicarboxylate metabolism
bamp00640  Propanoate metabolism
bamp00650  Butanoate metabolism
bamp00900  Terpenoid backbone biosynthesis
bamp01100  Metabolic pathways
bamp01110  Biosynthesis of secondary metabolites
bamp01120  Microbial metabolism in diverse environments
bamp01130  Biosynthesis of antibiotics
bamp01200  Carbon metabolism
bamp01212  Fatty acid metabolism
bamp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B938_05080
   00630 Glyoxylate and dicarboxylate metabolism
    B938_05080
   00640 Propanoate metabolism
    B938_05080
   00650 Butanoate metabolism
    B938_05080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B938_05080
   00072 Synthesis and degradation of ketone bodies
    B938_05080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B938_05080
   00310 Lysine degradation
    B938_05080
   00380 Tryptophan metabolism
    B938_05080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B938_05080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B938_05080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B938_05080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamp04147]
    B938_05080
Enzymes [BR:bamp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B938_05080
Exosome [BR:bamp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B938_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFZ90044
Position
complement(1042150..1043241)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFVKAGAGSTYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKAHEDGLYRREILPCHG
FAADENMLKKRNMEPLISRAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
GLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERDLSPDDIDIYEINEAFAVKICVFSQQLL
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacggacgattttcgcccgggaaaacggcctgtta
aaagactgtctcccagaagatttggcagctccgctgatccgccatttgagccggaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaatctcgcc
cggctgtcagccttggccgccgggcttcctttgagcgtgtccggtacgaccatcgacagg
cagtgcggctccggattggacgccgtgagggtcgcgtgccactttgttaaagccggcgcg
gggagcacatacatcgcgggaggagcggagagcagcagccgttcccctttctcatcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcagccgagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggatgaatatgcccttctcagctatgaa
cggagcgtcaaggcgcacgaagacggcttgtaccgccgggaaatccttccctgccacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatctcccgtgcc
aaacccgtctttcagtccggaggctctgtcaccgccgccaacagctgcggaatttctgac
ggggcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagccg
ggattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagct
ccggtgtatgccgtcaaaaaacttttgaaggaacgggacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcta
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system