KEGG   Bacillus velezensis AS43.3: B938_05360Help
Entry
B938_05360        CDS       T02382                                 

Definition
(GenBank) CypC
  KO
K15629  fatty-acid peroxygenase [EC:1.11.2.4]
Organism
bamp  Bacillus velezensis AS43.3
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bamp00199]
    B938_05360
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.4  fatty-acid peroxygenase
     B938_05360
Cytochrome P450 [BR:bamp00199]
 Cytochrome P450, bacteria type
  CYP152 family
   B938_05360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AFZ90098
Position
1095211..1096461
Genome map
AA seq 416 aa AA seqDB search
MDEQIPHEKGLDNSLALLRDGYVFVKNRAENYRSDVFRARLLGKTFICMSGAEAAKLFYD
TERFQREHALPKRVQKTLFGTGAIQSMDGERHKHRKLLFMSLLTPPRQKRLAEAVAKQWK
ASAEMWEGSNRIVLFDEAKKVLCRAACEWAGVPLKDSEVKERAEDFTDMVDAFGAVGPRH
WKGRRARLKTEKWIEEVIEDVRSGKLQTPEGSALYEMAFHTELDGNRLDSHMAAVELINV
LRPIAAISYFITFSALALHDYPEYRGKLRSRDDQEAERFAHEVRRYYPFAPFLGAVVKKD
FVWKNCEFKKGASVMLDLYGTNHDSRLWENPNEFRPERFQGREENKFDFIPQGGGDPANG
HRCPGEGMTVEVMKTSLAFLANEIEYDVPSQDLSFSLSRMPALPESGFVISDVRRI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacaaattccgcatgaaaagggtcttgataatagtctggctttattacgcgat
ggttatgtatttgtgaaaaaccgagcggagaattatcgctcggatgtgtttcgcgcccgt
ttattagggaagacattcatttgtatgagcggagcggaagccgcaaagcttttttatgac
acagaacgatttcagcgggagcatgccctccccaaacgggtgcagaaaacgttattcgga
acaggggcaatccagtcaatggacggtgaacggcataagcacaggaagcttctatttatg
tcgctgttgacgccgccccggcaaaaacggcttgcggaagcggtggcaaaacagtggaaa
gcatctgcggaaatgtgggagggttcaaaccgaattgtcctttttgatgaagcgaagaaa
gtgctgtgccgggctgcctgtgagtgggccggcgtcccgctgaaagactcagaagtgaaa
gagcgggcggaggatttcaccgatatggtagacgcattcggcgctgtgggaccgcgtcat
tggaaaggcagaagggcgaggctgaaaacggagaaatggatagaggaggtcattgaggat
gtgcggtccggcaagctgcaaacgccggagggctcagccttgtatgaaatggcttttcat
acagaacttgacgggaacagacttgattctcacatggctgctgttgagcttattaatgtt
ctgcgcccgattgctgccatttcttacttcattacgttttcagctcttgcattgcatgat
taccctgaatatcggggcaaactgagatcgagagatgatcaggaggctgaaagatttgca
catgaagttcggcggtattacccgtttgccccgtttttaggagccgttgtgaaaaaagat
ttcgtatggaagaactgtgagtttaaaaagggtgcatccgtcatgcttgacctatatggg
acaaaccatgattcccggctttgggaaaatcccaatgaatttcgcccggaacgttttcag
gggcgggaggaaaataaatttgatttcattccccagggcggaggtgatccggctaatggc
caccgctgtccgggtgagggaatgaccgtggaagtcatgaaaacttcccttgcgtttctt
gccaatgaaatagagtacgatgttccgtcccaagatttgagcttcagcctgtccagaatg
ccggcattgcctgaaagcggattcgtgataagtgatgttagacgcatatag

DBGET integrated database retrieval system