KEGG   Bacillus velezensis AS43.3: B938_09865Help
Entry
B938_09865        CDS       T02382                                 

Definition
(GenBank) DhaS
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00010  Glycolysis / Gluconeogenesis
bamp00053  Ascorbate and aldarate metabolism
bamp00071  Fatty acid degradation
bamp00280  Valine, leucine and isoleucine degradation
bamp00310  Lysine degradation
bamp00330  Arginine and proline metabolism
bamp00340  Histidine metabolism
bamp00380  Tryptophan metabolism
bamp00410  beta-Alanine metabolism
bamp00561  Glycerolipid metabolism
bamp00620  Pyruvate metabolism
bamp00625  Chloroalkane and chloroalkene degradation
bamp01100  Metabolic pathways
bamp01110  Biosynthesis of secondary metabolites
bamp01120  Microbial metabolism in diverse environments
bamp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B938_09865
   00053 Ascorbate and aldarate metabolism
    B938_09865
   00620 Pyruvate metabolism
    B938_09865
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B938_09865
   00561 Glycerolipid metabolism
    B938_09865
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B938_09865
   00310 Lysine degradation
    B938_09865
   00330 Arginine and proline metabolism
    B938_09865
   00340 Histidine metabolism
    B938_09865
   00380 Tryptophan metabolism
    B938_09865
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B938_09865
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B938_09865
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B938_09865
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     B938_09865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC PYNP_C MMS19_N
Motif
Other DBs
NCBI-ProteinID: AFZ90989
Position
2084969..2086456
Genome map
AA seq 495 aa AA seqDB search
MSSLTMQITKRLETFLQGTKKLYIDGKFVPSTSGSTFVTPNPATGETLMTLYEAQSEDID
SAVKAARKAFDHGEWRTMPAASRSRLMYKLADLMEEHKTELAQLETLDNGKPINETTNGD
IPLAIEHMRYYAGWSTKITGQTIPVAGSYFNYTRHEPVGVVGQIIPWNFPLLMAMWKMGA
ALATGCTIVLKPAEQTPLTALYLAELIDQAGFPDGVINIVPGFGETAGEALTNHDDVDKL
AFTGSTEIGKKIMEKAAKKIKRVTLELGGKSPNIILPDANLKKAIPGALNGVMFNQGQVC
CAGSRVFIHKDKYDEVVSEMVSYAKSLQQGAGLHQDTQIGPLVSQEQHERVLSYIEKGKA
EGAKAVAGGSCPFEEGYFVSPTVFADVDDSMTIAKEEIFGPVLAAIPYDTVDEVIERANR
SEYGLAAGLWTENVKNAHYIADRLQAGTVWVNCYNVFDAASPFGGYKQSGLGREMGSYAL
NNYTEVKSVWINLED
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttaacgatgcagatcacaaaaaggctggaaacatttttacagggtacgaag
aaactttatattgacggaaaatttgttccgagcacttcaggatcaacatttgtcacaccg
aatccggcaaccggagaaacgctgatgacgctttacgaggcacagtcagaagacattgac
agtgcagtgaaagcggcacgcaaagcctttgatcacggcgaatggcgcactatgccggcc
gcttccagaagcaggctgatgtataagcttgccgatttaatggaagagcacaaaacggaa
ctcgcgcagcttgaaacacttgataacggaaaaccgattaatgaaacgacgaatggggat
atcccgcttgcaattgagcatatgcgttattatgccggatggtctacaaagataaccgga
caaacgattccggtcgctggctcatattttaattacacccgccatgagcctgtcggcgtc
gtggggcagatcatcccttggaacttcccgctccttatggcgatgtggaaaatgggcgcc
gcccttgccacaggctgcacaatcgttttgaaaccggcggaacagacaccgctgaccgcc
ctctatttagcggagttaatagatcaggcgggcttccctgacggcgtcatcaatattgtc
ccagggttcggcgagacggccggggaagcgctgaccaaccatgacgatgtcgataaactc
gcttttaccggttctacagaaatcggcaaaaaaatcatggaaaaagccgcaaaaaaaatt
aaacgcgtgacactggagcttggcggaaagtcacctaacatcattttgcctgacgccaat
ttgaagaaagccattcccggcgctttaaacggggtcatgtttaatcaggggcaggtatgc
tgcgcaggctcccgtgtcttcattcacaaagacaaatatgatgaggtcgtcagcgaaatg
gtttcatatgcgaaatcgcttcagcaaggcgccggccttcaccaagatacacaaatcggc
ccgctcgtcagtcaggaacagcatgagcgcgtgctttcatatattgaaaaaggaaaagcg
gaaggagccaaagctgtcgcgggcggcagctgcccgtttgaagaagggtattttgtctcc
ccgactgtatttgcggatgtggatgacagcatgaccatcgcaaaagaagaaattttcggc
cctgttttagccgccattccgtatgatacggtagatgaagtcattgagcgggcgaaccgc
tcggaatacggccttgcagccggactttggactgagaatgtgaaaaacgcccattacatt
gctgaccgtctccaagccggcaccgtttgggtcaactgctacaatgttttcgatgcggca
tctcctttcggcggctataagcaatccggcctcgggcgggaaatgggctcttacgcgctg
aataattatacagaagtgaaaagcgtctggatcaatctggaagattaa

DBGET integrated database retrieval system