KEGG   Bacillus velezensis TrigoCor1448: AJ82_01490Help
Entry
AJ82_01490        CDS       T03161                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00564  Glycerophospholipid metabolism
bamt01100  Metabolic pathways
bamt01110  Biosynthesis of secondary metabolites
Module
bamt_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AJ82_01490
Enzymes [BR:bamt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AJ82_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AHK47870
Position
249693..250508
Genome map
AA seq 271 aa AA seqDB search
MFNTAAKILYRSLIELTNNRLTSYLIKNFCESKLSKPMIPLFSKHYRINWNETERTASDF
DSLASFFIRDINLNLRPVAKEKNAIVSPVDGVVQTVGMIKPNQTFMVKGKDYSFAELTGF
KSADHKYNGGCFAVLYLSPRHYHRFHSPVSCTYQKLAELGKRSYPVNTMGLKYGKDVLSK
NYRYVYELTRADQQMLMIPVGAMNINSIVQTNTGNRLETGEELGYFSFGSTVILVFEKDM
FTPSDNLTEGRELQVGQIIGYAESQEEASAL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatactgccgctaaaattctttaccgttcattgattgaactgactaataatcga
ttgacgtcttatctcattaaaaacttctgtgaatcgaaactgagcaagccgatgattccg
ctgttttccaaacactatcgcatcaactggaatgaaacggaacgcacggcttctgacttt
gattcactggcgtcatttttcattcgtgatattaatttgaatctccgccccgtggcaaaa
gagaagaacgccatcgtcagcccggtggacggtgtcgttcagacggttggcatgattaaa
cccaatcaaactttcatggtaaaagggaaggattattcgttcgccgaactgacggggttt
aaaagcgccgatcacaagtataacggcgggtgttttgccgtgctttacctgagcccgaga
cattaccaccgcttccattctcccgtcagctgcacgtatcagaagctggccgagctgggg
aaacgctcctatcccgttaatacgatggggttaaagtacgggaaagacgtgctctcaaaa
aattaccgttatgtgtacgagctgacccgtgctgaccagcagatgctcatgattccggta
ggtgcgatgaatattaactcgatcgttcagacaaacaccggaaacaggcttgagacgggg
gaagagctgggctatttttcatttggatcgaccgttattttagtattcgagaaagatatg
tttaccccttcggataacctgactgaaggccgtgaattacaggtcggccagatcatcggt
tatgcggagtcacaggaggaggcgtccgctttataa

DBGET integrated database retrieval system