KEGG   Bacillus velezensis TrigoCor1448: AJ82_05925Help
Entry
AJ82_05925        CDS       T03161                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00071  Fatty acid degradation
bamt00072  Synthesis and degradation of ketone bodies
bamt00280  Valine, leucine and isoleucine degradation
bamt00310  Lysine degradation
bamt00362  Benzoate degradation
bamt00380  Tryptophan metabolism
bamt00620  Pyruvate metabolism
bamt00630  Glyoxylate and dicarboxylate metabolism
bamt00640  Propanoate metabolism
bamt00650  Butanoate metabolism
bamt00900  Terpenoid backbone biosynthesis
bamt01100  Metabolic pathways
bamt01110  Biosynthesis of secondary metabolites
bamt01120  Microbial metabolism in diverse environments
bamt01130  Biosynthesis of antibiotics
bamt01200  Carbon metabolism
bamt01212  Fatty acid metabolism
bamt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AJ82_05925
   00630 Glyoxylate and dicarboxylate metabolism
    AJ82_05925
   00640 Propanoate metabolism
    AJ82_05925
   00650 Butanoate metabolism
    AJ82_05925
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AJ82_05925
   00072 Synthesis and degradation of ketone bodies
    AJ82_05925
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AJ82_05925
   00310 Lysine degradation
    AJ82_05925
   00380 Tryptophan metabolism
    AJ82_05925
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AJ82_05925
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AJ82_05925
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AJ82_05925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamt04147]
    AJ82_05925
Enzymes [BR:bamt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AJ82_05925
Exosome [BR:bamt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AJ82_05925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHK48603
Position
complement(1054955..1056046)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSSLAAGLPLSVSGTTIDRQCGSGLDAVRVACHFVKAGAGSTYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSIKAHEDGLYRPEILPCHG
FAADENMLKKRNMEPLISRAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
GLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERDLSPDDIDIYEINEAFAVKICVFSQQLR
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacggacaattttcgcccgggaaaacggcctgtta
aaagactgtctcccagaagatttggcagctccgctgatccgccatttgagccggaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaatctcgcc
cggctgtcgtccttggccgccggacttcctttgagcgtgtccggtacgaccatcgacagg
cagtgcggctccggactggacgccgtgagggtcgcgtgccactttgtcaaagccggcgcg
gggagcacgtacatcgcgggaggagcggagagcagcagccgttcccctttctcatcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcagcagagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcatcaaagcgcacgaagacggcttgtaccgcccggaaattcttccctgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatctcccgtgcc
aagcccgtctttcagtccggaggctctgtcaccgccgccaacagctgcggaatttctgac
ggggcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagccg
ggattacgttttatcggaagtgcggtaagcggggtccatccgcattatccgtcagcagct
ccggtttatgccgtcaaaaagcttttgaaggaacgggacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcga
gtgccgtattctaaaataaatgtcaggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system