KEGG   Bacillus velezensis TrigoCor1448: AJ82_14375Help
Entry
AJ82_14375        CDS       T03161                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00471  D-Glutamine and D-glutamate metabolism
bamt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AJ82_14375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bamt01011]
    AJ82_14375
Enzymes [BR:bamt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AJ82_14375
Peptidoglycan biosynthesis and degradation proteins [BR:bamt01011]
 Precursor biosynthesis
  Racemase
   AJ82_14375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AHK50063
Position
complement(2702091..2702906)
Genome map
AA seq 271 aa AA seqDB search
MEQPIGVIDSGVGGLTVAKEIMRQLPKENIIYVGDTKRCPYGPRPEEEVLQYTWEMTDYL
LENHHIKMLVIACNTATAIALEDIQRKTDIPVVGVIQPGARTAIKVTKNQHIGVIGTVNT
IKSRAYEQALLGLNAELQVENTACPLLVPFVESGRFLQESAEEAVEASLEPLKGTSIDTL
ILGCTHYPILKDPIQNYMGEHVKIISSGDETAREVSTILSYKGLLNQSKHAPEHQFLTTG
ERNGFAKIAEDWFGHEIGHVECISLQEPVRK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttggaacagccgataggagtcattgattccggggttggcgggttaaccgttgctaaggaa
atcatgagacagctaccgaaggaaaatatcatctatgtgggagatacaaaacgctgcccg
tacggcccgcgtcctgaagaagaagttcttcaatacacgtgggaaatgaccgattacctg
ctggaaaaccaccatatcaaaatgctcgtgatcgcctgcaatacggccacggccattgcc
ttggaggatattcagcgcaaaacggatattccggttgtcggcgtcattcagccgggtgcg
agaacggcgataaaggtcacgaaaaaccagcatatcggcgtcatcggcacggtcaatacc
attaaaagcagagcgtatgagcaggcgctgctcggattaaacgcagaacttcaagttgag
aacacggcttgtccgctgctcgtgccgtttgtggaaagcggacggtttcttcaggaatca
gcggaggaagcggttgaagcatcgcttgagcctttaaaaggtacatcaattgacaccttg
attttaggatgtacgcattatccgattttaaaagatccgattcagaactatatgggagag
catgtgaaaatcatttcctccggagacgagacggcgagagaagtgagcaccatcttgtct
tataaaggtttgttaaaccaatcgaaacatgcaccggagcatcaatttcttacaacggga
gagcggaacggcttcgcaaaaattgccgaagactggttcggccacgaaatcggccatgtc
gagtgcatctcccttcaagagccggtcagaaaataa

DBGET integrated database retrieval system