KEGG   Bacillus velezensis TrigoCor1448: AJ82_21115Help
Entry
AJ82_21115        CDS       T03161                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00230  Purine metabolism
bamt00250  Alanine, aspartate and glutamate metabolism
bamt01100  Metabolic pathways
Module
bamt_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AJ82_21115
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AJ82_21115
Enzymes [BR:bamt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AJ82_21115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AHK51222
Position
complement(3894512..3895804)
Genome map
AA seq 430 aa AA seqDB search
MSSVVVVGTQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIKFDGVTYKLHLIPSGIF
YKEKACVIGNGMVVDPKALITELAYLHERNVSTDNLRISNRAHVILPYHLKLDEVEEERK
GANKIGTTKKGIGPAYMDKAARIGIRIADLLDRDVFAEKLERNLEEKNRLLEKMYETEGF
KIEDILDEYYEYGQQIKKYVCDTSVVLNDALDEGRRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPTKIQHVVGVSKAYTTRVGDGPFPTELKDEIGDQIREVGREYGTTT
GRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGIETLKICVAYRYKGEVIEEFPASL
KALAECEPVYEEMPGWTEDITGAKTLSDLPENARHYLERVSQLTGIPLSIFSVGPDRSQT
NVIRSVYRAN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtagtcgtagtaggtacgcagtggggcgatgaaggaaaaggtaaaattaca
gatttcctatcagaaaatgcagaagtgatcgcacgttatcaaggcggaaacaatgcagga
cataccatcaagtttgatggcgtcacgtacaagcttcatttaatcccatcaggaattttt
tataaagaaaaagcgtgtgtcatcgggaacggaatggttgttgatccgaaagcgctcata
acagagcttgcgtatcttcatgaacgcaatgtgagcacggataacttgagaatcagcaac
agagcccacgtcattcttccataccatctgaaactggatgaagtagaggaagaacgcaaa
ggggccaataagatcggcacaacgaaaaaaggcatcggacctgcttatatggacaaagcg
gcgcggatcggcatccggatcgcagacctgctagatcgtgacgtgtttgcagaaaagctt
gaacggaacctagaagagaaaaaccgtctgcttgaaaaaatgtatgaaacagaaggcttc
aaaattgaagatattctggatgagtattatgaatacggccagcagattaaaaagtatgta
tgcgatacatccgtcgtcttaaatgacgcgctggatgaaggccgccgcgttttatttgaa
ggcgctcaaggggttatgcttgatattgaccaagggacatacccgtttgtcacttcatcc
aacccggtcgccggaggggtgacgatcggttcaggcgtaggcccgacaaaaatccagcac
gtcgtcggtgtatctaaagcgtacacaacccgtgtcggtgacggtccttttccgactgag
ctgaaagatgaaatcggggatcaaatccgtgaagtcggacgcgaatacggcacaacgaca
ggccgtccgcgccgtgtcggctggtttgacagcgttgttgtccgccacgcccgccgcgtc
agcggaatcacagatctttctctgaactcaatcgatgtgctgactggcattgaaacattg
aaaatctgtgtcgcttaccgctacaaaggtgaagtgattgaagaattcccggcaagtctg
aaagctctcgcagagtgtgaaccggtatatgaagaaatgcctggctggacggaagatatc
acaggcgcaaaaacattaagcgatcttcctgaaaatgcgcgccattatctggaacgcgtg
tctcagctgacaggtattccgctttctattttctctgtcggtcccgaccgttcacaaacg
aacgtcatccgcagtgtataccgcgctaactaa

DBGET integrated database retrieval system