KEGG   Bacillus velezensis SQR9: V529_25180Help
Entry
V529_25180        CDS       T03384                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bamy  Bacillus velezensis SQR9
Pathway
bamy00071  Fatty acid degradation
bamy00072  Synthesis and degradation of ketone bodies
bamy00280  Valine, leucine and isoleucine degradation
bamy00310  Lysine degradation
bamy00362  Benzoate degradation
bamy00380  Tryptophan metabolism
bamy00620  Pyruvate metabolism
bamy00630  Glyoxylate and dicarboxylate metabolism
bamy00640  Propanoate metabolism
bamy00650  Butanoate metabolism
bamy00900  Terpenoid backbone biosynthesis
bamy01100  Metabolic pathways
bamy01110  Biosynthesis of secondary metabolites
bamy01120  Microbial metabolism in diverse environments
bamy01130  Biosynthesis of antibiotics
bamy01200  Carbon metabolism
bamy01212  Fatty acid metabolism
bamy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V529_25180 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    V529_25180 (mmgA)
   00640 Propanoate metabolism
    V529_25180 (mmgA)
   00650 Butanoate metabolism
    V529_25180 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V529_25180 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    V529_25180 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V529_25180 (mmgA)
   00310 Lysine degradation
    V529_25180 (mmgA)
   00380 Tryptophan metabolism
    V529_25180 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    V529_25180 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V529_25180 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V529_25180 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamy04147]
    V529_25180 (mmgA)
Enzymes [BR:bamy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     V529_25180 (mmgA)
Exosome [BR:bamy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V529_25180 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: AHZ16544
Position
complement(2612415..2613596)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LTKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGVAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaatttggcggcgca
ttaaaagaggtaaaggcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatgggaatggtcgtccaggcgggt
gccgggcagattccggcacggcaggctgcaagatatgccgggcttccgtggtccgttccg
gctgaaaccattaataaggtctgtgcatcagggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggggacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagccagaaacgtgcggcagaggcggctgaagcgggcaaattgcgtgaagaaatcgtt
cccgtcacctggaccggcaaaaagggcaaacagcatactgttgaagcggatgaggggctg
cgtcctgatacgagccttgagcagcttgcagcgctcaagccaatttttacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggccggagcatttgtgctgatg
tcagaggaaaaagccgcaaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tcagtcggactggaagcgtccgagctggcaagcgcgccgggagaggccatcagccggctt
ttgacaaaaaccggactgtccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtcgtgctggtgagtgaaaaaatagccgggttcagccgggaaaaagtgaatgta
aacggaggggcaatcgcgttcggccacccgatcggcgcaagcggagcaagaatcatcatg
agtttaatatacgaattaaagcgtcgcggaggggggttaggcgtagctgctatatgcagc
ggagcggctcaaggagatgccgtcctgcttgaggtgtactga

DBGET integrated database retrieval system