KEGG   Bacillus anthracis Ames: BA_0348Help
Entry
BA_0348           CDS       T00129                                 

Definition
(RefSeq) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00051  Fructose and mannose metabolism
ban01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BA_0348
Enzymes [BR:ban01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BA_0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 1087393
NCBI-ProteinID: NP_842895
UniProt: A0A2P0H9B7
Position
359391..360032
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDCYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANHIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagagagaagagattgtagcgtacggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgcgagcaaggtcttgtt
gccattagcccaagtggtttagattgttatgaaacaaagcctgaagatgtagttatatta
aacttagatggtgaagtagtagagggagagagaaaaccatcaagtgaactcgatatgcac
cttatttattatagaaatcgtgaagatataaatgcgcttgtgcatacacattctccttat
gcgaagacgattgcatcattaggatgggaactgcccgcagtatcatatttaattgctttc
gcaggcccgaatgttcgctgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gctgctttcgaaggaatgatcgatcgtcgtgctgttttacttgcgaaccacggtttaatt
gcgggtgcaaatcatatcaaaatggcatttaccgttgcagaagaaattgagttttgtgcg
caaatttattatcaaacgaaaagcattggggaaccgaagctattgccagaagacgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system