KEGG   Bacillus anthracis Ames: BA_2588Help
Entry
BA_2588           CDS       T00129                                 

Definition
(RefSeq) hypothetical protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00010  Glycolysis / Gluconeogenesis
ban00071  Fatty acid degradation
ban00350  Tyrosine metabolism
ban00625  Chloroalkane and chloroalkene degradation
ban00626  Naphthalene degradation
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01130  Biosynthesis of antibiotics
ban01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BA_2588
  Lipid metabolism
   00071 Fatty acid degradation
    BA_2588
  Amino acid metabolism
   00350 Tyrosine metabolism
    BA_2588
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BA_2588
   00626 Naphthalene degradation
    BA_2588
Enzymes [BR:ban01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BA_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C Flag1_repress
Motif
Other DBs
NCBI-GeneID: 1086996
NCBI-ProteinID: NP_844955
UniProt: A0A0F7RGZ3
Position
2410949..2411875
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKCLKWKTCKIKSIQDDEIIVKTIAGAISIGAELPQFKGSDVTDMNPIYP
RKTGYESYGEVIQVGNKVTNLKVGDRVVSFYGHDTIGIVKGDKVIRVPSYIEPKDALLSI
LSCDAAKGILKLNPRQNEKILITGMGVIGLLACYFLKYYVGVKHVDVVEPNKNRRDFAKK
FCAKNIYESEEQIKEAFHYGFECSATNSGFHTLQKALKTNGQICILSDGNIEELTLTADF
YQKELQIIGSSDGYDYQKHADWFFSQIEQTPWIEEIFQHEIQYTELIQCFEELNQGIITP
LKVFVSYK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaatgccttaagtggaaaacgtgtaaa
ataaagtctatacaggatgatgaaattatcgttaaaacaattgcaggggcaataagtatt
ggagcagagttaccgcagtttaaaggatccgatgttacagatatgaatcctatttatcca
agaaaaactggatatgaaagttatggtgaggttattcaagttgggaataaagtaacaaat
ttaaaagtaggtgatagggtagtttctttttatggacatgatacgataggaatagttaaa
ggggataaagtaattcgagtgcctagttatatagaacctaaagatgccttattatctatt
ctttcgtgtgatgctgctaaaggcatattgaaactaaacccacgacagaatgaaaagata
cttataactggaatgggagttataggtttacttgcttgttatttcttaaaatactatgta
ggtgttaagcatgtagatgttgtcgaacctaataaaaatagaagagattttgcaaagaag
ttttgtgcaaaaaacatatatgaatcagaagaacaaataaaagaagcatttcattacggt
ttcgaatgttctgctacaaatagcggatttcatacattacaaaaagcacttaaaactaat
ggacaaatatgtatactttctgatggtaatattgaagaattaacattaaccgccgatttt
tatcagaaagaattgcaaatcattggttcaagtgatgggtatgattatcaaaaacatgca
gattggttttttagtcaaatagaacaaacaccatggatagaagagatttttcaacatgaa
atacaatatacagaactcattcaatgttttgaggaattaaatcaaggaataattacccct
ttaaaagtatttgtctcatataaataa

DBGET integrated database retrieval system