KEGG   Bacillus anthracis Ames: BA_3687Help
Entry
BA_3687           CDS       T00129                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00071  Fatty acid degradation
ban00072  Synthesis and degradation of ketone bodies
ban00280  Valine, leucine and isoleucine degradation
ban00310  Lysine degradation
ban00362  Benzoate degradation
ban00380  Tryptophan metabolism
ban00620  Pyruvate metabolism
ban00630  Glyoxylate and dicarboxylate metabolism
ban00640  Propanoate metabolism
ban00650  Butanoate metabolism
ban00900  Terpenoid backbone biosynthesis
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01130  Biosynthesis of antibiotics
ban01200  Carbon metabolism
ban01212  Fatty acid metabolism
ban02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ban00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BA_3687
   00630 Glyoxylate and dicarboxylate metabolism
    BA_3687
   00640 Propanoate metabolism
    BA_3687
   00650 Butanoate metabolism
    BA_3687
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BA_3687
   00072 Synthesis and degradation of ketone bodies
    BA_3687
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BA_3687
   00310 Lysine degradation
    BA_3687
   00380 Tryptophan metabolism
    BA_3687
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BA_3687
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BA_3687
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BA_3687
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ban04147]
    BA_3687
Enzymes [BR:ban01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BA_3687
Exosome [BR:ban04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BA_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 1085222
NCBI-ProteinID: NP_845950
UniProt: A0A2P0HHB6
Position
complement(3388375..3389466)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGMERAIDDVILGNVVGPGGNV
ARLSALEAGLGHHIPGVTIDRQCGAGLEAIRTACHFIQGGGGKCYIAGGVESTSTSPFQN
RARFSPETIGDPNMGVAAEYVAESYNITREMQDEYACLSYKRTLQALAKGYIHEEILSFN
GLLDESIKPEMNYERIIKRTKPAFLHNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPNLPGTGPIFAVNKLLNERNMKVEDIDYFEINEAFASKVVACAKELQ
IPFGKLNVNGGAIALGHPYGASGAMLVTRLFYQAKRERMKYGIATLGIGGGVGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaagcgaaaaggacacctattggtaagaagaatgggatg
ttaaaagactatgaagttcagcaattagcagcaccgcttcttacatttttaagtaaagga
atggagagagcgatagacgatgtcatattagggaatgttgttgggccaggagggaatgtt
gcgagattatctgctttagaagcagggcttggtcatcatattccgggtgtaacgattgac
cgacaatgtggtgccggattggaagcgattcgcaccgcatgtcatttcattcaaggcggg
ggcggtaagtgttatatcgccggaggagtagagagtacaagtacgtcaccttttcaaaat
agggcgcgattttcaccagaaacaattggcgatcctaatatgggagtagcggctgagtat
gttgcagaaagttataacatcacgagagaaatgcaagacgagtatgcatgcctcagttat
aaacgaacactgcaagcattagcaaaaggatatatacatgaggaaatattgtcttttaat
ggattgctagatgaatccattaagccagaaatgaattatgaacgaatcattaaaagaaca
aaacctgcatttttacacaatggtacagtaacggcaggtaattcgtgcggtgtaaatgat
ggagcatgtgccgttcttgtaatggaagagggacaagcccgaaaattaggatacaagcct
gtacttcgtttcgttcgtagtgctgtagttggagtggatcctaaccttccggggactggt
ccgatatttgcggtgaacaaattattaaacgaaaggaatatgaaagtagaggacatcgat
tattttgaaataaatgaagcatttgcctcaaaagttgtagcttgtgcaaaggagttacaa
attcctttcggaaaattaaatgtaaatggtggggcaattgcgcttggtcatccgtacggt
gcatctggggctatgcttgtaacgcgcttgttttatcaggcgaaacgagagcgtatgaaa
tatggaatcgcaacgttaggaatagggggcggggtaggtcttgcactattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system