KEGG   Bacillus anthracis Ames: BA_4487Help
Entry
BA_4487           CDS       T00129                                 

Gene name
glcK
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00010  Glycolysis / Gluconeogenesis
ban00052  Galactose metabolism
ban00500  Starch and sucrose metabolism
ban00520  Amino sugar and nucleotide sugar metabolism
ban00521  Streptomycin biosynthesis
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01130  Biosynthesis of antibiotics
ban01200  Carbon metabolism
Module
ban_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ban_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BA_4487 (glcK)
   00052 Galactose metabolism
    BA_4487 (glcK)
   00500 Starch and sucrose metabolism
    BA_4487 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BA_4487 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BA_4487 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BA_4487 (glcK)
Enzymes [BR:ban01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BA_4487 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-GeneID: 1087979
NCBI-ProteinID: NP_846712
UniProt: A0A0J1HY51
Position
complement(4080438..4081421)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtgtacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggt
gaattaaaaagtaagttaatcggtattggtatgggagctcctggtcctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaaaaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaatttagcggcactt
ggtgaaatgtggaagggtgctggtgaaggagcaaaagatttaatttgtatgacacttggc
actggtgttggcggcggtgtaattgccaatggtgagattgtacatggcgtaagcggtgct
gctggtgagattggacacattacagtcgttacagagaatgctttcccatgtaattgcggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtacgtgttgctatgcag
aaaatacaagagactgataaagaaagtattctacgttctatgttagcagaagaagggcgt
attacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttcgagcacgttgaat
ccagagaaaattgttattggtggaggcgtttctaaagctggagatgcactattagaacca
attcaacgttatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system