KEGG   Bacillus anthracis Ames: BA_4983Help
Entry
BA_4983           CDS       T00129                                 

Definition
(RefSeq) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00270  Cysteine and methionine metabolism
ban00920  Sulfur metabolism
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ban00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BA_4983
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BA_4983
Enzymes [BR:ban01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BA_4983
    2.3.1.46  homoserine O-succinyltransferase
     BA_4983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 1084216
NCBI-ProteinID: NP_847177
UniProt: A0A348AB12
Structure
PDB: 

Position
complement(4520724..4521848)
Genome map
AA seq 374 aa AA seqDB search
MQIVKKEKFILKEYTFENGRTIPVQMGYETYGTLNRERSNVILICHYFSATSHAAGKYTA
HDEESGWWDGLIGPGKAIDTNQYFVICTDNLCNVQVKNPHVITTGPKSINPKTGDEYAMD
FPVFTFLDVARMQCELIKDMGIARLHAVMGPSAGGMIAQQWAVHYPHMVERMIGVITNPQ
NPIITSVNVAQNAIEAIRLDPSWKGGKYGEEQPMKGLQLANRMMFMNAFDEHFYETTYPR
NSIEVEPYEKVSSLTSFEKEINKLTYRSIELVDANSWMYTAKAVLLHDIAHGFSSLEEAL
SNVEANVLMIPCKQDLLQPSRYNYKMVDLLQKQGKYAEVYEIESINGHMAGVFDIHLFEK
KVYEFLNRKVSSFV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaattgtaaaaaaggagaagtttattttaaaggagtatacatttgaaaatggtagg
acaattcctgttcaaatggggtatgagacgtatggtactttaaatagagagagatccaat
gtgattttgatttgtcattattttagtgcaactagtcacgcggcaggaaaatatacagcg
catgatgaggagtctggctggtgggatggtttaattggaccgggaaaagcaattgataca
aatcaatactttgttatatgcactgataatctttgtaatgtgcaggtgaagaaccctcat
gtaattacaacggggccgaaatcaattaatccgaaaactggagatgaatatgcgatggat
tttccggtttttacatttcttgatgtagctcgtatgcaatgcgagttaataaaagatatg
ggaatcgcaaggttacacgctgtaatgggaccatcagctggcgggatgattgcgcagcaa
tgggctgttcattaccctcatatggtagagcggatgattggtgttattacgaacccacaa
aatccaattattacgtcggtaaatgtagcgcaaaatgcaattgaggctatccggctggat
ccgagttggaagggcgggaaatatggagaagagcagccaatgaaggggcttcagttagca
aatagaatgatgtttatgaacgcgtttgatgagcatttttatgaaacaacctaccctcgt
aatagtatagaagtggaaccgtatgaaaaggtttcttcattaacatcatttgagaaagag
ataaacaaattgacatatagaagtatagagttagtagatgcaaattcgtggatgtacact
gcgaaagcagttttattacatgacattgcgcatggattttcgtctttagaagaggcgctg
tctaatgtagaagcaaatgtacttatgattccgtgtaaacaagatttgcttcagccgtca
cgttataattataaaatggtagacctattgcaaaaacaagggaagtatgcagaagtatat
gagatagaaagtataaatgggcatatggcgggagtatttgatattcatttatttgaaaag
aaagtgtatgagtttttaaatcggaaagtatctagctttgtgtag

DBGET integrated database retrieval system