KEGG   Bacillus anthracis Ames: BA_5170Help
Entry
BA_5170           CDS       T00129                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00300  Lysine biosynthesis
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01130  Biosynthesis of antibiotics
ban01230  Biosynthesis of amino acids
Module
ban_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ban00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BA_5170 (dapF)
Enzymes [BR:ban01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     BA_5170 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase PhzC-PhzF Pro_racemase
Motif
Other DBs
NCBI-GeneID: 1084119
NCBI-ProteinID: NP_847354
UniProt: Q81XR2
Structure
PDB: 

Position
complement(4698393..4699259)
Genome map
AA seq 288 aa AA seqDB search
MSQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAP
VKMRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTL
AKIDMGAPRLTRAEIPMLGEGETPFIRENFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAP
LTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILN
GKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYKIEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattttcttttacaaaaatgcatggtcttggcaatagttatatatatgtaaat
atgtttgaagaacaaattcctgaagaagatttagctcttgtggcggaaaaggtttcaaat
attaatactggtattggagccgatggaatgattttaatttgtccatctgacgtagcacct
gtgaaaatgcgcatgtttaataatgatggatcagaaggaaagagctgtggtaacggtcta
cgctgcgtagcgaaatatgcgtatgagcataaactagtagaagatacagttttcacaatt
gaaacgttagctggcattgtaacggcggaagtaacggtagaagaagggaaagttacgtta
gcgaaaatcgatatgggagcacctcgtttaacacgtgcagaaataccgatgcttggtgaa
ggtgaaacaccatttattcgtgaaaacttcttatacaataatcatcgttatgcatttaca
gctgtttcaatgggaaatccgcatgcggttatttttgtggatgatgtagaacaagcacct
cttacaacacttggaccagttcttgagacacatgaaatgttcccagaacgagtaaatgtt
gaattcattgagattttgaatgaggaagagatgaacttccgcgtttgggaacgtggatct
ggcgtaacacaagcttgcggaacaggggcgtgtgctgcagttgtagcctctattttaaat
ggaaagatggaacgtggtaaggaaattacagttcatttagctggtggcgatttaatgatt
gcatggacagaagaaggcaacgtgttaatgaaaggaccagcagaagtaatttgccgcgga
gtgtatgagtacaagatagaagcgtaa

DBGET integrated database retrieval system