KEGG   Bacillus anthracis Ames: BA_5617Help
Entry
BA_5617           CDS       T00129                                 

Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00330  Arginine and proline metabolism
ban01100  Metabolic pathways
Module
ban_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BA_5617
Enzymes [BR:ban01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BA_5617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 1085325
NCBI-ProteinID: NP_847769
UniProt: Q81JT1
Position
complement(5105006..5105878)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIKSHPSFEESEVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDAGKFPLGLGGEHLVSWPIFK
AMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIGPENVYSFGIRSGMKEEF
EWAKEVGMNLYKFDVLEPLKEVLPKLEGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKE
LLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttattaaaagtcatccaagttttgaa
gagtcagaggtagttatttacgggatgcctatggattggacagtaagttaccgtccagga
tctcgctttggccctgcacgtattcgtgaagtatcaatcggtcttgaagaatatagtccg
tatttagatcgtgaactagaagaggtaaaatattttgatgcgggtgatatcccattacca
tttggaaatgcacaacgcagcttagacatgattgaagaatatgtatcaaaacttttagat
gccggtaagtttccactaggtctcggcggtgagcacctagtgtcttggccaatttttaag
gcaatggcaaaaaaatatccggatttagcaatcatccatatggatgctcatactgattta
cgtgaatcgtatgaaggggagcctttatcccactctacacctattcgtaaagtgtgtgat
ttaattggtccggaaaacgtatattctttcggaattcgttctggaatgaaggaagaattt
gaatgggcgaaagaagtaggtatgaacttatacaaatttgacgtattagaaccgttaaaa
gaagtattaccgaaacttgagggacgcccagtctatgtcacaatcgacattgatgtatta
gacccagctcacgctccaggaacaggaacgttagaagctggtggtatcacatctaaagaa
ttattagattccatcgtagcaattgcaaattcaaatataaatgtagttggagcagactta
gtagaagtagctcctgtctacgaccatagtgatcaaacaccagtcgcagcaagcaaattc
gtgcgggaaatgctgctcggttgggtaaagtaa

DBGET integrated database retrieval system