KEGG   Candidatus Bipolaricaulis anaerobius: BARAN1_0387Help
Entry
BARAN1_0387       CDS       T05525                                 

Definition
(GenBank) Type-1 restriction enzyme R protein (fragment)
  KO
K01153  type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
bana  Candidatus Bipolaricaulis anaerobius
Brite
KEGG Orthology (KO) [BR:bana00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bana02048]
    BARAN1_0387
Enzymes [BR:bana01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     BARAN1_0387
Prokaryotic defense system [BR:bana02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   BARAN1_0387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3387
Motif
Other DBs
NCBI-ProteinID: SQD92412
UniProt: A0A2X3KJ62
Position
BARAN1:complement(372280..373410)
Genome map
AA seq 376 aa AA seqDB search
MRGHGLMQAIARVNCVFKDKPGGLVVDYLGLADQLKRALANYTESGGKGQTAINQEEAVA
VMLERYEVCCGIFHGFDWSTWITGDPQARLSVLPAAQEHVLAQDDGKNRLVKAVGELSKA
FALAVPHEKALEIRHDVAFFQAVKSVLTKSTGEGRRSSEEVEFAIRQIVSKAVSSDEVID
IFAAAGLKKPDISILSDEFLTEVRGMPQRNLAVEMLRKLLEGEIKARGRKNLVQARSFAE
LLENAIKKYQNRAIETAQVIEELIALAKDLREAGRRGEKLGLTDDEVAFYDALETNDSAV
QVLGNETLQAIARELVRVVRANVTIDWTLRENVRAQLRVLVKRVLRKYGYPPDKQEQATR
TVLEQAEALSAEWALA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggccacgggctgatgcaggccatcgcgcgagtgaactgcgtgttcaaggataag
cccggcggcctggtggtggactatctgggcctggccgaccagctaaagcgggccttggcc
aactataccgagagcgggggcaaggggcagacagctattaatcaggaagaggccgtggcg
gtcatgctggagcgctacgaggtttgttgcggaatattccacggcttcgactggtcgaca
tggattacgggtgatccgcaggcgcggctatcggtgctgccggcggcgcaggaacacgtg
ctggctcaggatgacggcaagaatcggcttgtgaaggcggtgggcgaattgtcgaaggcg
tttgcgctcgctgtcccgcatgagaaggcgctggaaattcggcacgacgtggccttcttc
caggccgtgaagtccgtacttacgaagagcacgggcgaaggccgtcgtagctcggaagag
gtggagttcgccattcggcagatcgtttcgaaggcggtgtcttcggatgaggtcatcgac
atcttcgcggccgccgggctgaagaagccggacatctcgatcctgtccgatgagttccta
acggaagtgcgcggcatgccgcaaaggaacttggcggtcgaaatgctgcgcaagcttctc
gaaggcgagatcaaggcacgcgggcgaaagaacttggtgcaggcccggtcgtttgccgag
cttcttgagaatgcgatcaagaaataccagaaccgggccatcgagacggcgcaggtgatc
gaagaattgatcgccttggcgaaggacctacgtgaggcgggccgacgcggagagaaactg
gggctcacggatgacgaggtggccttctacgacgcgctggagacgaacgatagcgcggtg
caggttctgggaaatgaaaccttgcaggcgatcgctcgcgagctggtgcgggtggtgcgc
gccaacgtgaccatcgactggaccctccgcgagaacgtgcgggcgcaactgcgggtgctc
gtgaagcgcgttctgcgcaagtacggctatccgccggacaagcaggagcaggccacgcgg
acggtcctggagcaggccgaggccctgtcagccgagtgggcgctggcctga

DBGET integrated database retrieval system