KEGG   Candidatus Bipolaricaulis anaerobius: BARAN1_0625Help
Entry
BARAN1_0625       CDS       T05525                                 

Gene name
manC1
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bana  Candidatus Bipolaricaulis anaerobius
Pathway
bana00051  Fructose and mannose metabolism
bana00520  Amino sugar and nucleotide sugar metabolism
bana01100  Metabolic pathways
bana01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BARAN1_0625 (manC1)
   00520 Amino sugar and nucleotide sugar metabolism
    BARAN1_0625 (manC1)
Enzymes [BR:bana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BARAN1_0625 (manC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase HicA_toxin
Motif
Other DBs
NCBI-ProteinID: SQD92649
UniProt: A0A2X3L0D9
Position
BARAN1:607858..608364
Genome map
AA seq 168 aa AA seqDB search
MRGSSQPTRPADHVIRYPDRFLAILDAAVRVVADGEHLVTLGIVPDRPATGYGYIRRGDR
LDQLGEVGVYRARGFTEKPDRNLAAQFISAGEYLWNSGMFVWRVDTLLNAIARHMPDLHA
ALREIEPHLGRPDWAEAVARQRGSHVQFVHAGKTIKPGTFSEMLRKAG
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgggagctctcaacccaccaggccggccgatcatgtcatccgctaccccgaccgg
ttcctggcgatcctggatgccgcggtgagggtggtcgcggatggggaacacttggtgact
ttggggatcgtcccggatcgcccagccacgggctacggatacatccgccgcggggaccgc
ctcgatcagctgggcgaggtcggtgtctaccgggcccgcgggttcacggagaagccggat
cggaacctagcagcccagttcatctccgcgggcgaatacctgtggaacagcgggatgttc
gtgtggagggtggacacgctcctcaacgccatcgcgagacacatgcctgatctccacgcc
gcgctgcgcgagatcgaaccccacctcggtcggccagattgggcagaggcggtggcgcgg
cagcggggtagtcatgtgcagttcgtacacgctggcaaaaccatcaaaccaggaacgttc
agcgaaatgctcaggaaagcgggctga

DBGET integrated database retrieval system