KEGG   Bartonella ancashensis: PU02_0966Help
Entry
PU02_0966         CDS       T04086                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
banc  Bartonella ancashensis
Pathway
banc00450  Selenocompound metabolism
banc00970  Aminoacyl-tRNA biosynthesis
banc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PU02_0966
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PU02_0966
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:banc01007]
    PU02_0966
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:banc03016]
    PU02_0966
Enzymes [BR:banc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PU02_0966
Amino acid related enzymes [BR:banc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PU02_0966
Transfer RNA biogenesis [BR:banc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PU02_0966
 Prokaryotic type
   Other AARSs
    PU02_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ALE03780
UniProt: A0A0M4LJ30
Position
1035468..1037024
Genome map
AA seq 518 aa AA seqDB search
MGDTYYITTPIFYPNASPHIGHAYNAVASDALARFQRLEGKDVFFLSGTDEHGLKMQQTA
DSLNILPQQLADRNSAIFQKMLKTLNCSNDDFIRTTEERHRETCQIIWQKMQDNGDIYLD
SYAGWYSVSQESYYEEKDTEVNEKGIRCEKELGSPVQWNEEESYFFKLSRYEEALLKHYE
KYPDFIAPNERRNEIISFVKSGLKDISISRTNFSWGISVPKDPKHIMYVWVDALTNYLTA
IDFFNKTSKKRIFWPVNTHIVGKDIIRFHAVYWPAFLMSAGIELPKRIFAHGFLLNRGSK
MSKSIGNVVDPFDMVNHYGVDQVRYFFLREVPFGQDGTYSHENLVNRINADLANDLGNLA
QRSLSMIQKNCDAKVPVPYSFLFQDQQLLEKADQVLDTTRQAMLAQAPHLALSAIFSLVA
DANRYFTSEEPWDLRKNDIKRFSTVIYVTAESLRRIGIMLLPFIPQSATKLLDSLAIVEE
DRLLSHIKTSKIREKSILPPPVAIFPRYVEGGDSNDVN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatacatattatataacaactccaattttttatcctaatgcttctccgcatatt
gggcatgcttataatgcagttgcaagtgatgcattggctcgttttcaaagattagaaggt
aaagatgttttttttctttctggcacagatgagcatggtcttaagatgcagcaaacagca
gattcgctaaatatactcccccaacaacttgcagatcgtaatagtgctattttccaaaaa
atgttgaaaacattgaattgttccaatgatgatttcatccgtacaacagaagaaagacac
cgtgaaacctgtcagataatttggcaaaaaatgcaagataatggcgatatttatctcgat
agttatgcaggttggtattctgtcagccaagaatcttattatgaagaaaaagatacagag
gtgaatgagaaaggaatacgctgtgaaaaagaattaggatctcctgttcaatggaatgaa
gaagaaagctatttttttaaattatcacgctatgaagaagcccttcttaaacattacgaa
aaataccctgattttatagctcccaatgaacgacgcaatgaaattataagttttgttaag
tcaggtttaaaagacatttcaatttcacgtactaattttagttggggaatttccgttcca
aaagatccaaaacatatcatgtatgtttgggttgatgcccttacaaattatctcacggca
atagatttttttaacaaaacttccaaaaagcgtattttttggcctgtaaatactcatatt
gtagggaaagacattatccgattccatgctgtttattggccagcttttttgatgtcagca
ggaattgagcttcctaaacgtatctttgcacacggttttttacttaatcgcggttccaaa
atgtctaaatccattggaaatgttgttgatccttttgatatggttaatcattatggagtt
gatcaggtgcgatacttttttttacgtgaagttcctttcgggcaagatggtacttacagc
catgaaaatttagttaatcgtattaatgcagacctcgctaatgatcttggaaacttagca
caacgttctttatcaatgattcaaaaaaattgtgatgcaaaagtccctgttccatatagc
ttcttgtttcaagatcagcaacttttagaaaaagcagatcaggtactagatacaacacgt
caagctatgttggctcaagcgcctcatttagcactttcagcaattttttcacttgtagca
gatgcaaatcgctattttacaagtgaagaaccttgggatttacgtaaaaatgatataaaa
agattttctacagttatttatgtaaccgcagaaagtcttcgaagaataggtattatgctt
ttgcctttcatccctcaatcagctactaagcttcttgatagccttgcaatcgttgaagaa
gatcgattattatcccatataaaaacttccaagataagggaaaaaagcattttaccacca
cccgtagcaatttttcctcgctatgttgaaggaggtgacagtaatgatgttaattga

DBGET integrated database retrieval system