KEGG   Bacillus anthracis HYU01: HYU01_00225Help
Entry
HYU01_00225       CDS       T03394                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00450  Selenocompound metabolism
banh00970  Aminoacyl-tRNA biosynthesis
banh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HYU01_00225
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYU01_00225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:banh01007]
    HYU01_00225
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:banh03016]
    HYU01_00225
Enzymes [BR:banh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HYU01_00225
Amino acid related enzymes [BR:banh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HYU01_00225
Transfer RNA biogenesis [BR:banh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HYU01_00225
 Prokaryotic type
   Other AARSs
    HYU01_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIF54539
UniProt: A0A4Y1WB81
Position
41597..43579
Genome map
AA seq 660 aa AA seqDB search
MTEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYNVHYLTGTDEHGQKIQ
KKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDI
YLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYV
DRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWV
DALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFA
HGWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINF
DLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFS
VALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVA
PSKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKGQPIFPRLEMDVEVAYIKEQMKASA
PKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEPVKKADKLLKIQLDLGTEKRQVVSG
IAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMILAGEENGVLSLASIDQNIPNGTKIK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggaaaacaaatccttttatattactaccccaatttattatccaagtggaaaa
ttacacattggacatgcttatacaacagtagcaggagatgcgatggcacgatataagtgc
atgcaaggatataatgttcattatttaacaggaactgatgagcatggacagaagatccaa
aagaaagcagaagaattaaacgttacaccacaagcatatgtggataacatcgttgcagga
attaaagaactttgggaaaagatggatatctcttatgatgattttattcgtacaacggaa
gatcgtcataaagatgttgttgaaaaaatcttcaagcaactagtagatcaaggtgatatt
tatcttgatgaatatgaaggttggtattctgtacaagatgagacattctatacggagcat
caattagtagatccaattatggaaggtgacaaagtagttggaggaaaaagtccagatagt
ggtcatgatgtagaacttgttcgtgaagaatcgtatttctttagaatgggtaaatatgtc
gacagactattaaaattctatgaagataatccacatttcattcagccagagtctcgtaag
aatgaaatgattaataacttcattaaaccaggcttagaagatttagcagtttctcgtact
tcatttgactggggagttcgtgttccaggtaatccgaaacacgttatttacgtatgggtt
gacgcactatctaactacattacagcattaggctatggaacagaaaatgaagagatgtat
aagaagttctggccggcagatgtgcatttagttggaaaagaaatcgttcgtttccataca
atttattggccaatcattttaatggcattagatttacctcttccgaaaaaagtctttgct
cacggttggattttaatgaaggatggaaagatgagtaagtcaaaaggaaatgtagtagat
ccagttatattaatcgatcgttacggattagatgcattacgttattacttacttcgtgaa
gttccattcggatctgatggcgtattcacaccagaaggatttgtggagcgtattaatttc
gatttagcaaatgacttaggtaacttattaaatcgtacagtagctatgattgataagtac
tttaacggagaaatccctgcatttaaagcaaatgtaacggaatttgatgaaacgttagta
acatttgcgaaagatacattgaaaaaagttgaagaagcaatggagaatatggaattctct
gtagctctaagctcaatttggcaattggttagccgtacgaataaatatattgatgaaaca
caaccatgggtattagcgaaagatgaggatgatcgtgaaaagttggcgtctgtaatggct
catttagcagaagtacttcgtcaaacgggtattatgcttatgccattcttaacagtagca
ccaagcaaaatgtttgctcagcttggccttactgatgaagcacatacatcttggggaagc
ctatctacaatcggctgtattccagctggaacaaaagtagaaaaaggacaaccaattttc
cctcgtttagaaatggacgtggaagtggcgtacattaaagaacaaatgaaagcctctgct
cctaaagtagaagagaaaaaagaagaagaaccgaaggcagaagaaattacaattgatgat
ttctttaaagtagaattgcgtgtagctgaagtactatctgctgaacctgtaaaaaaggca
gataagttgttgaaaattcaactagacttaggtacagaaaagcgtcaagttgtttctgga
attgcaaaattctattcgccagaagacctaaaaggtaaaaaggttatttgtgtaacaaat
ttaaaacctgtaaaattacgcggtgaattatcgcaaggtatgattttagcgggtgaagag
aatggtgtattgtcattagcatctattgaccaaaatataccaaatggtacaaaaatcaag
taa

DBGET integrated database retrieval system