KEGG   Bacillus anthracis HYU01: HYU01_01680Help
Entry
HYU01_01680       CDS       T03394                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00250  Alanine, aspartate and glutamate metabolism
banh00330  Arginine and proline metabolism
banh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HYU01_01680
   00330 Arginine and proline metabolism
    HYU01_01680
Enzymes [BR:banh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     HYU01_01680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SPW
Motif
Other DBs
NCBI-ProteinID: AIF54776
UniProt: A0A1S0QRF5
Position
304409..305956
Genome map
AA seq 515 aa AA seqDB search
MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEKITTEDKIVSVNPANK
EELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIEYNRFSYIPLGVGVIISP
WNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGSE
VGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVNPGQIWLKRVIAEMGGKDTIVVDKEAD
LELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRAVELTKELTVANPAVLGTNMG
PVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQPTIVADVAEDARLMKEEIFGP
VVAFCKAKDFDHALAIANNTEYGLTGAVISNNRDHIEKAREDFHVGNLYFNRGCTGAIVG
YQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagcatacaaacatgagccatttacagatttttcagtagaggctaacaaatta
gcgtttgaagaaggtttaaagaaagtagaatcttatcttggacaagactatccattaatt
attgggggagaaaaaatcactacagaagacaaaattgtttctgtaaaccctgcaaataaa
gaggaacttgttggtcgcgtttcaaaagcaagccgtgagttagctgaaaaagcaatgcaa
gtagcggatgaaacattccaaacttggagaaagtcaaaaccagaaatgcgtgcagacatt
ttattccgtgctgcagcgatcgttcgtcgtagaaaacatgaattctctgctattcttgta
aaagaagcaggtaaaccgtggaatgaggcagatgctgatacagcagaagcaatcgacttt
atggaatattatggtcgccaaatgttgaaattaaaagacggaattccagtagaaagccgt
ccaattgaatataatcgtttctcttacattccattaggagtaggtgttatcatttctcct
tggaacttcccattcgcaattatggcaggtatgacaacagctgctttagtttctggtaac
acagtattactaaaaccagctagtacaactcctgtagtagcagcgaaattcatggaagta
ttagaagaagctggcttaccagctggcgtagtaaacttcgtaccaggtaatggttctgaa
gttggtgactacttagtagatcaccctcgtacacgcttcattagcttcactggatctcgt
gatgtaggtatccgtatttatgagcgcgcagcgaaagtaaacccaggccaaatctggtta
aaacgcgttatcgctgaaatgggtggtaaagatacaattgttgttgataaagaagcagat
cttgaattagcagctaaatctatcgttgcatcagcattcggattctcaggacaaaaatgt
tctgcatgttctcgtgcagtaatccacgaagatgtatacgatcacgtattaaatcgtgct
gttgaattaacgaaagaattaacagttgctaacccagctgtattaggtacaaacatgggt
cctgttaatgaccaagctgcattcgataaagtaatgagctatgttgcaattggtaaagaa
gaaggtagaattttagcaggtggcgaaggagacgactctaaaggctggttcatccaacca
acaatcgttgctgacgttgcagaagatgctcgcctaatgaaagaagaaatcttcggacca
gtagtagcattctgtaaagcaaaagactttgatcatgcacttgcaattgcaaacaataca
gaatacggtttaacaggagcagttatctctaacaaccgtgatcatattgaaaaagcacgt
gaagacttccacgtaggtaacttatacttcaaccgtggatgtactggtgcaatcgtagga
taccaaccattcggtggctttaacatgtctggtacagactctaaagctggtggtcctgac
tacttagcgcttcacatgcaagcaaaaactacttctgaaactttataa

DBGET integrated database retrieval system