KEGG   Bacillus anthracis HYU01: HYU01_03635Help
Entry
HYU01_03635       CDS       T03394                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HYU01_03635
Enzymes [BR:banh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HYU01_03635
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HYU01_03635
    1.1.1.-  
     HYU01_03635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N CoA_trans Gp_dh_N CMAS
Motif
Other DBs
NCBI-ProteinID: AIF55117
UniProt: A0A347ZZD6
Position
680441..681493
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNSLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagtaccagaacca
actgtaaaaccaggagcagttaagattaaagttaaatggtgtggtatctgcgggacagac
ttgcatgaatatttagcaggacctatttttattccgacagaagagcatccattaacacat
gtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaaatcggtgaa
ggcgttacatctcataaagtgggagaccgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggttcac
catattccagatgaaatgacgtatgaacaaggtgctcttgtagaaccagcagcagtagcg
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagcagtagcagtctttggttgt
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatt
gcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgcggattacgta
ttgaatccagcgactcaagatgtattagctgaaattcgcaacttaacaaatagtttaggt
gtaaatgtaagctttgaagtaactggtgttgaagtagtacttcgtcaagcaattgaaagc
acaagctttgaaggacaaactgtaattgttagtgtatgggaaaaagacgcaacaattact
ccaaataatcttgtactaaaagaaaaagaagtggttggtattttaggataccgtcatatc
ttcccagctgttattaaattaattagctctggtcaaattcaagcagagaaattaattacg
aaaaaaatcacagtagatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system