KEGG   Bacillus anthracis HYU01: HYU01_09950Help
Entry
HYU01_09950       CDS       T03394                                 

Definition
(GenBank) 3-dehydroshikimate dehydratase
  KO
K15652  3-dehydroshikimate dehydratase [EC:4.2.1.118]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
banh01100  Metabolic pathways
banh01110  Biosynthesis of secondary metabolites
banh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HYU01_09950
Enzymes [BR:banh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.118  3-dehydroshikimate dehydratase
     HYU01_09950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AIF56246
UniProt: A0A1S0QSG8
Structure
PDB: 

Position
1857806..1858648
Genome map
AA seq 280 aa AA seqDB search
MKYSLCTISFRHQLISFTDIVQFAYENGFEGIELWGTHAQNLYMQEYETTERELNCLKDK
TLEITMISDYLDISLSADFEKTIEKCEQLAILANWFKTNKIRTFAGQKGSADFSQQERQE
YVNRIRMICELFAQHNMYVLLETHPNTLTDTLPSTLELLGEVDHPNLKINLDFLHIWESG
ADPVDSFQQLRPWIQHYHFKNISSADYLHVFEPNNVYAAAGNRTGMVPLFEGIVNYDEII
QEVRDTDHFASLEWFGHNAKDILKAEMKVLTNRNLEVVTS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattcactatgtaccatttcatttcgccatcaattaatttcatttactgatatt
gttcaatttgcatatgaaaacggttttgaaggcattgaattatgggggactcatgcacaa
aatttgtatatgcaggagtatgaaacgacagaacgagaattgaattgtttaaaggataaa
accttggaaattacgatgataagtgattacttagatatatcattatcggcagattttgaa
aaaacgatagagaaatgtgaacaacttgcaatactagctaattggtttaaaacgaacaaa
attcgtacgtttgctggacaaaaaggtagtgcagatttttcgcaacaagagagacaagag
tatgtgaatcgtattcgcatgatttgtgaattatttgctcagcataatatgtatgtactt
ttagaaacacacccaaatacgttaacggatacgttgccttctactttggaattattaggc
gaagtagatcatccgaatttgaaaataaatcttgattttcttcatatatgggagtctggt
gcagatccagttgacagcttccagcaactaagaccgtggatacaacattaccattttaag
aatatatcttcagcagattatttacatgtgttcgaaccgaataatgtatatgcagcagcg
ggaaatcgtactggtatggttccattatttgaaggcattgtaaattatgatgagattatt
caggaagtgagagatactgatcatttcgcttcactcgaatggtttggacataatgcgaaa
gatatattaaaagcagaaatgaaagtactaacaaatagaaatttagaagtagtaacttct
taa

DBGET integrated database retrieval system