KEGG   Bacillus anthracis HYU01: HYU01_16635Help
Entry
HYU01_16635       CDS       T03394                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00361  Chlorocyclohexane and chlorobenzene degradation
banh00625  Chloroalkane and chloroalkene degradation
banh01100  Metabolic pathways
banh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HYU01_16635
   00361 Chlorocyclohexane and chlorobenzene degradation
    HYU01_16635
Enzymes [BR:banh01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     HYU01_16635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: AIF57460
UniProt: A0A3P1U3Y2 Q81N25
Position
complement(3106708..3107418)
Genome map
AA seq 236 aa AA seqDB search
MKYKVILFDVDDTLLDFPETEKHALHNAFVQFGMPTGYTDYLASYKEISNGLWRDLENKM
ITLSELAVDRFRQLFALHNIEVDAQQFSDVYLKNLGKEVHLIEGAVQLCEKLQDCKLGII
TNGYTKVQQSRIGNSPLRNFFEHIIISEEVGHQKPAREIFDYAFEKFGITDKSSVLMVGD
SLTSDMRGGEDYGIDTCWYNPSLKENKASVKPTYEVESLLQILELVEVAEEKVVSF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaagttatattattcgacgtagacgatacattattagatttccctgaaacg
gaaaaacacgcattacataatgcgtttgtacagttcggtatgcctacagggtatactgat
tatcttgcaagttataaagagattagtaatgggttatggagagatttagaaaataaaatg
attacgctaagtgaattagcggtagatcgatttagacaattgtttgcactgcataatata
gaagtagatgcgcagcaatttagtgatgtatatcttaaaaacttagggaaagaagtacat
cttatagaaggtgcagtgcaattatgtgagaagctacaagattgcaagctaggtatcatt
acgaatggatatacgaaggtgcaacaatctagaattggaaattcgcctttacgtaatttc
tttgaacatattattatttctgaagaggttggccatcaaaaaccagcacgtgagattttt
gattatgcgtttgaaaagtttggaattacggataaatcaagtgtactaatggttggagat
tcgctcacttctgatatgagaggcggagaagattacggcattgatacgtgttggtataat
ccgagtttgaaagagaataaggcaagtgttaagccgacttatgaagtggagagtctgctg
caaattttagaacttgtagaagtggcggaagaaaaggtagtatcattttaa

DBGET integrated database retrieval system