KEGG   Bacillus anthracis HYU01: HYU01_20720Help
Entry
HYU01_20720       CDS       T03394                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00071  Fatty acid degradation
banh00072  Synthesis and degradation of ketone bodies
banh00280  Valine, leucine and isoleucine degradation
banh00310  Lysine degradation
banh00362  Benzoate degradation
banh00380  Tryptophan metabolism
banh00620  Pyruvate metabolism
banh00630  Glyoxylate and dicarboxylate metabolism
banh00640  Propanoate metabolism
banh00650  Butanoate metabolism
banh00900  Terpenoid backbone biosynthesis
banh01100  Metabolic pathways
banh01110  Biosynthesis of secondary metabolites
banh01120  Microbial metabolism in diverse environments
banh01130  Biosynthesis of antibiotics
banh01200  Carbon metabolism
banh01212  Fatty acid metabolism
banh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:banh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HYU01_20720
   00630 Glyoxylate and dicarboxylate metabolism
    HYU01_20720
   00640 Propanoate metabolism
    HYU01_20720
   00650 Butanoate metabolism
    HYU01_20720
  Lipid metabolism
   00071 Fatty acid degradation
    HYU01_20720
   00072 Synthesis and degradation of ketone bodies
    HYU01_20720
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HYU01_20720
   00310 Lysine degradation
    HYU01_20720
   00380 Tryptophan metabolism
    HYU01_20720
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HYU01_20720
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HYU01_20720
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HYU01_20720
Enzymes [BR:banh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HYU01_20720
Exosome [BR:banh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HYU01_20720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIF58209
UniProt: A0A0J1KEN4
Structure
PDB: 

Position
complement(3866311..3867486)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatggggattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaatggt
agtggtgtaggacttggacatccaattggttgtacaggagctcgtattactgtaagttta
attcatgaattaaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggagtagcattatttatagaagcactataa

DBGET integrated database retrieval system