KEGG   Bacillus anthracis HYU01: HYU01_21165Help
Entry
HYU01_21165       CDS       T03394                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00740  Riboflavin metabolism
banh00790  Folate biosynthesis
banh01100  Metabolic pathways
banh01110  Biosynthesis of secondary metabolites
Module
banh_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    HYU01_21165
   00790 Folate biosynthesis
    HYU01_21165
Enzymes [BR:banh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     HYU01_21165
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     HYU01_21165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AIF58296
UniProt: A0A0B5XCI6
Position
3941136..3942329
Genome map
AA seq 397 aa AA seqDB search
MFHRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPIT
EGYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFN
RPGHIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCA
KQFDIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGD
ISTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLL
NKLRAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQ
GYDLTVTERVPLQMPAKEENKTYLQTKVNKLGHLLNL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatcgtattgaagaagctctagaagatttaaaacaaggaaaagtcgttatcgta
tgtgatgatgaaaaccgtgaaaacgaaggcgattttatcgctttagcagagtatattacg
cccgaaacaattaactttatgattacacatggacgcggtctcgtttgtgtaccgattacg
gaaggatacgcagaacgtctacaattagaaccaatggtatctcataatacagattcgcat
catactgcatttacagtgagcattgaccatgtttctacaacaacaggcattagcgctcac
gaacgtgcaactacaatacaacaattgttaaatcctgcatcaaaaggtgctgatttcaat
cgacctggacatatctttccattaatcgcgaaagaaggcggtgtcctgcgtcgtgctggt
catacagaagctgctgtcgatttagcacagctttgcggagcagaaccagctggagtcatt
tgcgagattatcaatgaggacggtacgatggcacgcgtccctgatttactacagtgtgca
aaacaatttgatataaaaatgattacaatagaagatttaattgcttatcgccgccatcat
gaaacacttgtgacgagagaagtggaaattacattacctacagatttcggtacttttcaa
gcaattggctattctaactcattagatacgaaagaacatattgcactcgtaaaaggtgat
atttcaacaggtgagcctgtacttgtacgcgttcattcagagtgcttaacaggagatgta
tttggctcgtgccgctgtgattgcggaccacaactccatgctgcacttgctcaaattgaa
cgtgaaggaaaaggcgttcttctttatatgagacaagaaggacgaggcattggccttctt
aataagcttcgcgcttataagttacaagaagaaggcttcgatactgtagaagcaaacgaa
aaacttgggtttcccgctgaccttcgtgattacggtatcggcgctcaaatattaaaagat
ttaggtttacaacatttacgattattaacgaataatccaagaaaaatcgctggcttacaa
ggttacgatttaaccgttacggagcgcgtaccgttgcaaatgccagcaaaagaagagaat
aaaacgtatttacaaacgaaagtaaacaaattaggacatttattaaacttataa

DBGET integrated database retrieval system