KEGG   Bacillus anthracis HYU01: HYU01_22365Help
Entry
HYU01_22365       CDS       T03394                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00360  Phenylalanine metabolism
banh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
banh00790  Folate biosynthesis
banh01100  Metabolic pathways
banh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    HYU01_22365
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HYU01_22365
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HYU01_22365
Enzymes [BR:banh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     HYU01_22365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIF58524
UniProt: A0A348A9Y1
Position
4151809..4153563
Genome map
AA seq 584 aa AA seqDB search
MTKKTEIPSHLKPFVSTQHYDQYTPVNHAVWRYIMRQNHSFLKDVAHPAYVNGLQSSGIN
IEAIPKVEEMNECLASSGWGAVTIDGLIPGVAFFDFQGHGLLPIATDIRKVENIEYTPAP
DIVHEAAGHAPILLDPTYAKYVKRFGQIGAKAFSTKEEHDAFEAVRTLTIVKESPTSTPD
EVTAAENNVIEKQNLVSGLSEAEQISRLFWWTVEYGLIGDIDNPKIYGAGLLSSVGESKH
CLTDAVEKVPFSIEACTSTTYDVTKMQPQLFVCKSFEELTEALEKFAETMAFKTGGKEGL
EKAIRSENHATAELNSGLQITGTFTETIENDAGELIYMRTSSPTALAIHNKELANHSTAV
HSDGFGTPIGLLTENIALENCTDEQLQALGITIGNIAEFTFESDIHVKGTVTDIVKNDNK
IALISFINCTVTYNDRVLFDASWGAFDMAVGSTITSVFPGAADAAAFFPMDEEIQEIPAP
LVLNELERMYQTVRDIRNEGILHDAHIEQLVAIQEVLNKFYTKEWLLRLEILELLLEHNK
GHETSAALLQQLSTFTTDEAVTRLINNGLTLLPVKGVKNDATIN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaacagaaattccatcgcatttaaaaccattcgtatccacacagcattat
gatcaatacacaccggtgaaccacgctgtatggcgttacattatgagacaaaatcatagt
ttcttaaaagacgttgcccatccagcctatgtgaatggactacaatcatctggtattaat
atagaggcaatcccaaaggtagaagaaatgaatgaatgtttggcgtcaagcggctggggc
gctgtaacgattgacggacttattcctggcgtcgcatttttcgattttcaagggcacgga
ttgctaccaatcgcaacagatattcgcaaagtagaaaacatcgagtatacacctgctcca
gatattgtacacgaagcagcaggacacgcacctattttacttgatcctacatatgcaaaa
tatgtaaaacgatttgggcaaattggtgcaaaagctttttctacaaaagaagaacatgat
gcattcgaggctgttcgtacattaacgattgtaaaagaaagccctacttctactcctgat
gaagttacagctgctgaaaataatgtaattgaaaaacaaaacttagtttctggcttatca
gaagcggaacaaatttcacgtcttttctggtggacagtggaatacggattgattggagat
atagacaatccaaaaatatatggtgctggtctcctttcttctgttggcgaaagcaaacat
tgcttaacagacgctgtagaaaaggttccattctctatagaggcatgtacaagtacaact
tatgacgtaacaaaaatgcaaccacaactatttgtttgtaaatcatttgaagaattaaca
gaagcacttgagaaatttgctgaaacgatggcctttaaaacaggtggtaaagaaggctta
gaaaaagcaattcgctctgaaaaccatgcaactgctgaattaaatagcggattacaaatt
acaggtacattcaccgagacaattgaaaacgatgcgggtgaattgatttatatgcgaaca
agttcgccaacagcattagccattcacaataaagagctagcgaatcattctacggctgta
cacagtgacggctttggaacaccgattggattactcactgaaaatattgcattagaaaat
tgtacagatgaacaactacaagcattaggaattacaattggaaatattgctgagtttact
tttgaaagtgatattcatgtaaaaggaacagtaacagatattgtaaaaaacgataataaa
atcgctcttatttcctttatcaattgtacagttacttataacgaccgcgttttatttgat
gcttcatggggcgcatttgatatggctgttggttcaacaatcacttccgtattcccaggt
gccgcagatgctgcagcatttttcccaatggatgaagaaattcaagaaattcctgctcca
cttgtactgaatgaacttgaacgtatgtatcaaacagttcgtgatatccgaaatgaaggt
attttacacgacgcacatatcgagcaattagtagcaattcaagaggtattaaataaattc
tatacgaaagaatggttacttcgccttgaaatattagaattgcttttagaacataacaaa
gggcacgaaacatcagcagcattattacaacaactttctactttcacaactgatgaagct
gtaacacgccttattaacaatggtcttacgctacttccagtaaagggtgtgaaaaatgat
gctacgattaactga

DBGET integrated database retrieval system