KEGG   Bacillus anthracis HYU01: HYU01_27250Help
Entry
HYU01_27250       CDS       T03394                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00010  Glycolysis / Gluconeogenesis
banh00030  Pentose phosphate pathway
banh00051  Fructose and mannose metabolism
banh00680  Methane metabolism
banh01100  Metabolic pathways
banh01110  Biosynthesis of secondary metabolites
banh01120  Microbial metabolism in diverse environments
banh01130  Biosynthesis of antibiotics
banh01200  Carbon metabolism
banh01230  Biosynthesis of amino acids
Module
banh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
banh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYU01_27250
   00030 Pentose phosphate pathway
    HYU01_27250
   00051 Fructose and mannose metabolism
    HYU01_27250
  09102 Energy metabolism
   00680 Methane metabolism
    HYU01_27250
Enzymes [BR:banh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HYU01_27250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase 4HFCP_synth
Motif
Other DBs
NCBI-ProteinID: AIF59423
UniProt: A0A3P1TWL0
Structure
PDB: 

Position
complement(5049595..5050452)
Genome map
AA seq 285 aa AA seqDB search
MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGF
KTVVAMVKALIEEMNITVPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETT
KKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAECKHLVEATGIDCLAPALGSV
HGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEF
TKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagtttctatgaaagaaatgctaaacaaagcactagaaggaaaatacgcagtt
ggtcaattcaacatgaacaacttagagtggactcaagctatcttagctgctgcggaagaa
gaaaaatctcctgtaatcctaggtgtatctgagggtgcagctcgtcatatgactggtttc
aaaacagttgtagctatggttaaagctttaatcgaagaaatgaacatcactgttcctgta
gcgattcaccttgaccatggttcaagcttcgaaaaatgtaaagaagcaatcgatgcaggt
ttcacatctgtaatgatcgacgcttctcaccacccattcgaagaaaacgtagaaactact
aaaaaagtagtagaatacgcacacgctcgtaacgtatctgttgaagctgagcttggaaca
gttggcggacaagaagacgacgtaatcgctgaaggcgtaatttacgctgacccagctgag
tgtaagcaccttgttgaagcaacaggtatcgattgcctagctccagctttaggttctgta
cacggtccttacaaaggtgagcctaacttaggattcgctgaaatggaacaagttcgtgac
ttcactggtgtacctttagtattacacggtggtactggtatcccaactgctgatatcgaa
aaagctatctctttaggtacttcaaaaatcaacgtaaacactgagaaccaaatcgagttt
acaaaagctgttcgtgaagtattaaacaaagaccaagaagtttacgatcctcgtaaattt
atcggacctggccgcgacgctatcaaagctactgttattggtaaaattcgcgaattcggt
tctaacggtaaagcgtaa

DBGET integrated database retrieval system