KEGG   Bifidobacterium animalis subsp. lactis Bl12: Bl12_0085Help
Entry
Bl12_0085         CDS       T02712                                 

Definition
(GenBank) rRNA (guanine-N1-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
bani  Bifidobacterium animalis subsp. lactis Bl12
Brite
KEGG Orthology (KO) [BR:bani00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bani03009]
    Bl12_0085
Enzymes [BR:bani01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Bl12_0085
Ribosome biogenesis [BR:bani03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Bl12_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS Ubie_methyltran Methyltransf_2 Methyltransf_4 Methyltransf_23 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AGO51603
Position
108995..109948
Genome map
AA seq 317 aa AA seqDB search
MSPEKLARFADSWKYFVCPLCREELRLEGTSLRCERGHTYDVARQGYVNLAPGARQSEYY
SRESFEHRGQILSAGYYSHIVDAVLSAVGRYCGQIAASIDFAGLRTRSGAQLRGARGRAD
LRSSGPQMRAPVILDVGCGEGFYARAVQAAHPDATVLAFDISKDSVQLAAREDAGCAVRW
FVGNLAELPVRDGAVDCVLDVFSPVNYAEFTRVLGGSGVVIKVVPGARHDEQLRELARGQ
LRHGDYSNEQVVGQFAEHFDVLERRLVSQTFPMPADDVLAFARMTPLLFNVDVDSLDLSR
IHELTVEAEILVGSVCG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggagaaattggcgcggtttgcggattcctggaaatacttcgtgtgcccgctg
tgccgtgaggagctgcggctggagggtacgagtctgcgttgcgaacgcggtcacacctac
gacgtggcgcggcaggggtacgtgaatctggcgcccggtgcgcggcagtcggaatattac
agcagagagtcgttcgagcaccgcgggcagattctctccgccggctattactcgcatatc
gtcgacgccgtgctgagtgccgtggggcggtattgcgggcagattgccgcgtccatcgat
ttcgcgggcctgcgcacgcgttccggcgcgcaattgcgcggcgcacgcgggcgtgcggat
ctgcgctcgagcgggccgcagatgcgcgcgccggtgatactcgacgtcggctgcggcgaa
ggattctatgcgcgcgccgtgcaggcggcgcatccggatgccacggtgctcgcgttcgac
atctccaaggattccgtgcagctggcggcgcgcgaagacgcggggtgcgcggtgaggtgg
tttgtggggaatctggccgaactaccggtgcgtgacggcgccgtggactgcgtgctcgac
gtgttctcgccggtcaactacgcggaattcacgcgcgtgctcggcggctcgggcgtggtg
atcaaggtggtgcccggcgcgcggcatgacgagcagctgcgcgagctcgcacgcggccag
ctgcgccacggcgactattcgaacgagcaggttgtggggcagttcgccgagcatttcgat
gtgctggaacgccggctcgtctcccagaccttcccgatgccggccgacgatgtgctcgcc
ttcgcccgcatgacgccgttgctgttcaacgtggacgtggattcgcttgatctctcccgg
attcatgagctcaccgtggaggcggagatcctcgtgggcagcgtgtgcgggtga

DBGET integrated database retrieval system