KEGG   Bifidobacterium animalis subsp. lactis ATCC 27673: BLAC_01940Help
Entry
BLAC_01940        CDS       T02862                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
banl  Bifidobacterium animalis subsp. lactis ATCC 27673
Pathway
banl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:banl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BLAC_01940 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:banl03011]
    BLAC_01940 (rplV)
Ribosome [BR:banl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BLAC_01940 (rplV)
  Bacteria
    BLAC_01940 (rplV)
  Archaea
    BLAC_01940 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGW84610
Position
476418..476777
Genome map
AA seq 119 aa AA seqDB search
MEAKAIARHVRVTPRKARRMVDLIRGKKATEAITILKFAPQDASTPVLKVLQSAIANARV
KADKAGEPFRENDLYIKETYVDEGVTLKRFRARAQGRAARINKRTSHITVVVASKEGDR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagcaatcgctcgccacgttcgtgtgacgccgcgtaaggctcgccgcatg
gtcgacctcatccgaggcaagaaagcgaccgaagccatcaccattctcaagttcgctccg
caggacgccagcaccccggtgctcaaggtcctccagagtgccatcgcgaacgcccgcgtg
aaggccgacaaggccggcgagccgttccgtgagaacgacctgtacatcaaggagacctat
gtggacgagggtgtgacgctcaagcgtttccgcgctcgtgcacagggccgtgccgctcgt
atcaacaagcgtacgagccacatcacggtcgtcgtcgctagcaaggaaggagaccgctaa

DBGET integrated database retrieval system