KEGG   Bacillus anthracis A16R: A16R_01250Help
Entry
A16R_01250        CDS       T02999                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
banr  Bacillus anthracis A16R
Pathway
banr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:banr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A16R_01250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:banr03011]
    A16R_01250
Ribosome [BR:banr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A16R_01250
  Bacteria
    A16R_01250
  Archaea
    A16R_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 BAR_3_WASP_bdg
Motif
Other DBs
NCBI-ProteinID: AHE81545
Position
124091..124432
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEH
NYEMDINSLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagcagtagcgagaacagttcgtattgctcctcgtaaagttcgtttagtt
gtagacttaatccgaggtaagcaagtgggtgaagcgattgctatccttaaccacacacca
aaaactgcttctccagttgtagaaaaagttttaaaatctgcaatcgcaaatgcagagcac
aattatgaaatggacatcaacagcctagttgttgagaaagttttcgttgacgaaggtcca
acgttaaaacgtttccgtccacgtgcaatgggtcgtgcaagccaaattaacaaacgcaca
agccacatcacagttgtggtatcagaaaagaaggagggataa

DBGET integrated database retrieval system