KEGG   Bacillus anthracis A16R: A16R_03670Help
Entry
A16R_03670        CDS       T02999                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
banr  Bacillus anthracis A16R
Pathway
banr00250  Alanine, aspartate and glutamate metabolism
banr00280  Valine, leucine and isoleucine degradation
banr00410  beta-Alanine metabolism
banr00640  Propanoate metabolism
banr00650  Butanoate metabolism
banr01100  Metabolic pathways
banr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:banr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A16R_03670
   00650 Butanoate metabolism
    A16R_03670
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A16R_03670
   00280 Valine, leucine and isoleucine degradation
    A16R_03670
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A16R_03670
Enzymes [BR:banr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A16R_03670
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     A16R_03670
Amino acid related enzymes [BR:banr01007]
 Aminotransferase (transaminase)
  Class III
   A16R_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHE81750
Position
332215..333579
Genome map
AA seq 454 aa AA seqDB search
MNTKKFAKVNEQIPGPKAASLLERRQNIVPKGVSNGIPTFVQSANGALVTDVDGNQYIDF
AGAIGTINVGHCHPAVKEALHKQVDQYIHTGFNVMMYEPYIELAEKLAALAPGSFDKQVL
FLNSGAEAVENAVKIARKYTKRPGIIAFSKGFHGRTLMTMTMTSKVKPYKFGFGPFAPEV
YKAPFPYEYRCPEGLTEEQYDDFMIEEFKNFFISEVAPETIAAVVMEPVQGEGGFIVPSK
KFAQEVRNICSEHGILFVADEIQTGFSRTGKYFAIDHYDVVPDLITVSKSLGAGVPISGV
IGRKEIMNESAPGELGGTYAGSPLGCAAALAVLDVIEKENLNDRAIELGKVVMNRFEEMK
NKYNCIGDVRGLGAMCAFELVQDRKTKTPDKTLTANLCTEANKRGLLLLSAGTYGNVIRV
LMPLVITDEQLEEGLTIIEESLQICYEKANTARV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaaaaaatttgctaaagtaaatgaacaaattcctggaccgaaagcagcgtct
ttactagaacgccgccaaaatatagtaccaaaaggagtaagtaacggcatcccaacgttt
gtacaatctgcaaacggtgctcttgtaacagatgttgatggcaatcagtacattgatttc
gctggagcgataggaacaattaacgtagggcattgtcacccagctgttaaagaagcgctc
cataaacaagtagatcaatacatccatacgggctttaatgtcatgatgtatgagccatat
attgaattagcagaaaaacttgcggcattagcaccaggaagttttgataagcaagtacta
tttttaaatagtggtgcagaagcagttgagaatgcggtgaaaatcgctcgtaaatataca
aaaagacctggcattatcgctttttctaaaggtttccacggacgtacattaatgacaatg
acgatgacaagtaaagtaaaaccatataaatttggatttggcccatttgctccagaagta
tataaagcgccattcccttatgaatatcgttgcccagaaggattaacggaagagcagtat
gatgactttatgattgaagagtttaagaatttcttcatatcagaagtagcaccagaaacg
attgcagccgttgtaatggaacctgttcaaggggaaggtggatttatcgtcccaagtaag
aagtttgcgcaagaagtacgcaatatttgttcagaacacggcatcttatttgtagcggat
gaaattcaaacaggatttagccgtacaggaaaatattttgccattgatcattatgatgtc
gttccggatttaattacggtatctaaatcattaggtgctggtgtaccaattagtggtgtt
attgggcgcaaggaaattatgaatgagtctgcaccaggagagcttgggggaacgtatgcg
ggaagcccgctaggatgtgcggcagcattagcagtacttgatgtaatagaaaaagagaat
ttaaatgatagagcgatagaattaggaaaagttgtaatgaaccgattcgaagagatgaaa
aataaatataattgcatcggtgatgtgcgcggtttaggagcaatgtgtgcattcgagctc
gttcaagaccgtaagacgaaaacacctgataaaacgttaacagctaatttgtgcacagaa
gcaaacaaacgcggcctacttctactatcagcaggaacatacggtaatgttattcgtgta
ctaatgccgctagttattacagatgagcaactggaagaaggattaacaattattgaagaa
tcattgcaaatttgttatgagaaagcaaatactgcccgtgtttaa

DBGET integrated database retrieval system