KEGG   Bacillus anthracis A16R: A16R_29070Help
Entry
A16R_29070        CDS       T02999                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
banr  Bacillus anthracis A16R
Pathway
banr00010  Glycolysis / Gluconeogenesis
banr00053  Ascorbate and aldarate metabolism
banr00071  Fatty acid degradation
banr00280  Valine, leucine and isoleucine degradation
banr00310  Lysine degradation
banr00330  Arginine and proline metabolism
banr00340  Histidine metabolism
banr00380  Tryptophan metabolism
banr00410  beta-Alanine metabolism
banr00561  Glycerolipid metabolism
banr00620  Pyruvate metabolism
banr00625  Chloroalkane and chloroalkene degradation
banr01100  Metabolic pathways
banr01110  Biosynthesis of secondary metabolites
banr01120  Microbial metabolism in diverse environments
banr01130  Biosynthesis of antibiotics
Module
banr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:banr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A16R_29070
   00053 Ascorbate and aldarate metabolism
    A16R_29070
   00620 Pyruvate metabolism
    A16R_29070
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A16R_29070
   00561 Glycerolipid metabolism
    A16R_29070
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A16R_29070
   00310 Lysine degradation
    A16R_29070
   00330 Arginine and proline metabolism
    A16R_29070
   00340 Histidine metabolism
    A16R_29070
   00380 Tryptophan metabolism
    A16R_29070
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A16R_29070
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A16R_29070
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A16R_29070
Enzymes [BR:banr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A16R_29070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHE84248
Position
complement(2627049..2628533)
Genome map
AA seq 494 aa AA seqDB search
MLTTNIELKPKVKAFLDEEIKMFINGEFVPSISGKTFETYNPATEDVLAVVYEAQEEDID
VAVKAARSAFESGPWVEMTTAERAHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDD
IAATVENYRYYAGWATKIIGQTIPISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGA
ALATGCTIVLKPAEQTPLSLLYTAKLFKEAGFPNGVVNFVPGFGPEAGAAIVNHHDIDKV
AFTGSTVTGKYIMRQSAETIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNC
SAGSRVFVHRKHYETVVNELVKMANNVKLGAGMEKDTEMGPLVSKKQQERVLHYIEQGKA
EGATVAAGGERAFEKGYFVQPTVFTDVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANR
SSYGLAAGVWTQNIKTGHQVANKLKAGTVWINDYNLENAAAPFGGFKQSGIGRELGSYAL
DNYTEVKSVWVNIK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgacaaatattgagttgaaaccaaaagtgaaagcgtttttagatgaagagatt
aaaatgtttattaatggtgaatttgttccttctattagtggaaagacgtttgaaacatat
aatccagcaacagaagatgttcttgcagttgtttatgaagcacaagaagaggatattgat
gtggcagtaaaagcggcgagatctgcatttgaatcaggaccttgggtggaaatgactact
gctgaaagagcacatcttatttataaattagcagacttaattgaagagcatggagaagaa
ttagcacagctagaagctttagataatggaaaaccatatcaagtagcacttgatgatgat
attgcagcgactgtagaaaattatcgctattatgcaggatgggctacaaaaattatcggg
caaaccattccgatttcaaaagattacttaaattacacacgccatgaacctgttggcgtt
gtagggcaaattattccttggaattttccgctcgttatgtcttcttggaaaatgggagct
gcgctagcaacaggttgtacgatcgtattaaaaccagcagaacaaactcctttatcttta
ttatatacagcgaagctctttaaagaggctggttttccaaacggtgttgtaaactttgtt
ccagggtttggtcctgaagcaggagctgcaattgtaaaccatcatgatattgataaagta
gcctttacgggttcaacagttactggaaaatatattatgcgtcaatctgcagaaacaatt
aaacatgtaacgttagaactgggtggtaaatcaccaaatatcattttagaagacgctgat
ttagaagaagcgattaacggtgcattccaaggtattatgtataatcacggtcaaaattgt
agtgctggatctcgcgtgttcgttcaccgaaaacattacgaaacagtcgtaaatgaactt
gtgaaaatggcgaataacgtgaaacttggagcaggtatggagaaggacacggaaatgggt
ccactcgtatctaaaaagcaacaagagcgtgtgctacattacattgaacaaggaaaagct
gaaggcgctactgttgctgctggtggtgaacgtgcatttgaaaaaggttattttgtacag
ccaacagtattcacagatgttacggacgatatgacgatagttaaggaagaaatcttcggt
cctgttgtcgttgtacttccatttgattcgacggaagaagtaattgaaagagcaaatcgt
tcgtcatatggacttgcagcgggcgtatggacacaaaatattaaaacaggacatcaagtt
gccaataagttaaaggcaggaacagtatggattaatgattataacttagaaaatgcagcg
gcaccatttggtgggtttaaacaatctggtatcggccgtgagttaggttcatatgcactt
gataattacacagaagtgaaaagtgtttgggtaaatataaagtaa

DBGET integrated database retrieval system