KEGG   Bacillus anthracis A16R: A16R_30740Help
Entry
A16R_30740        CDS       T02999                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
banr  Bacillus anthracis A16R
Pathway
banr00730  Thiamine metabolism
banr00790  Folate biosynthesis
banr01100  Metabolic pathways
banr02020  Two-component system
Module
banr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:banr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A16R_30740
   00790 Folate biosynthesis
    A16R_30740
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A16R_30740
Enzymes [BR:banr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A16R_30740
Exosome [BR:banr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A16R_30740
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:banr00537]
 Enzymes
  A16R_30740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Cu_amine_oxidN1
Motif
Other DBs
NCBI-ProteinID: AHE84415
Position
complement(2770227..2771900)
Genome map
AA seq 557 aa AA seqDB search
MSELALKMKRLLLVGTIILSMLCTESLMNYHTAEAKVKKVERKPKNVIIMVMDGTSSTAT
TLARLYKGKPLALDEIVTGGVRTYSAESAITDSAPAATALATGNKSNSGYVGVLPSIVSS
SGLKPMKEEDKLRPVANVLEGAKRTGRATGIVATAEIQHATPAGFSAHHVNRNNFEVLAE
QQVYQNIDVVLGGGKAALLPETDSGIRKDGEDLVKVIKNKGYDFVETKEALLGSKSNKIW
GSFSLNALAFDMDREATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHVNDP
IGMISDVLAFDNAVAEALKFAKKDGNTMLIAVADHGNSGISIGNMNTTKGYNTTPISAYI
YPLKKAKMTLEGTINNLKADISNVEEVAKLYGLDNLTYDEKERLKTAKKKIDVGPIFTTL
LSKRANIGFTTGGHTGEDVFLYSYGPQKPYGLIQNTDVAKTMAKAMGFNLEKVTNKLFVE
SESAIKQNDAAVTIDKTDVANPVLIVKRNNVTAQLFVNKNIIRIKNKEYELGSVVVESNG
KVYVPEEAIHLFRKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagttagctttaaagatgaagagattactgttagtaggaacaatcatactaagt
atgttatgtactgaaagtttgatgaattatcatacagcggaagctaaagtgaaaaaagta
gaacgcaagcctaaaaatgtaatcataatggttatggacggaacaagttctacagcaact
acattagctcgcttgtataaagggaaaccacttgcattagacgaaattgtaacaggagga
gttcgtacatattcggcggaatcagctataacagactcagctccagcagctacagcttta
gcgacggggaataaatcaaattcaggatatgtaggtgtattaccttcaattgtaagttca
tctggcttaaaaccaatgaaagaagaggataagttacgaccagttgccaatgttttagaa
ggtgcaaaacgtacgggtcgcgcaactggaattgttgctacagctgaaattcagcatgct
actcctgctggattctccgctcatcatgtgaatcgtaacaatttcgaagtgctcgcggag
caacaagtatatcaaaatatagatgtcgtattaggtgggggaaaagcagcacttctacct
gagacagatagtgggattcgaaaagacggtgaagatttagtaaaagtgatcaaaaacaaa
ggttacgactttgttgaaacgaaagaagcattattaggctctaaatctaataaaatttgg
ggctctttctcgcttaatgctttagcatttgatatggatcgtgaagcaacaaacccagag
caaccaacactttctcaaatgacggaaaaagcaattcaaacgttatcaaaagataaagat
ggcttctttttatttgtggaaggaagtaagccagactgggcagctcatgtgaatgatcca
attgggatgattagtgatgtattagcatttgataatgcagttgcagaagcattgaagttt
gcaaaaaaagatggtaatacgatgctaatagccgtagcggaccatggtaatagcggtatt
tctattgggaatatgaatacgacaaaaggatataatactacgccgatctctgcgtacatt
tatccattgaaaaaagcgaagatgacacttgaagggactatcaataatttgaaagctgat
atatcaaatgtagaagaggtagctaaattatacgggttggacaatttaacttatgatgaa
aaagaaaggttaaaaacggctaaaaagaaaatagatgtaggtccaattttcactacatta
ttgtctaagcgtgcgaacataggcttcacaacaggagggcatacaggtgaggatgtattc
ttatattcatacggtcctcaaaagccatacggtttgattcaaaatacggacgttgcgaag
acgatggcgaaagcgatgggctttaacttagaaaaagtaacaaacaaattatttgtagaa
agtgaatcagccattaagcagaatgatgcagctgtaacaatagataaaactgatgtagcg
aaccctgtactcatagtaaaacgtaataatgtaacagctcaattatttgttaacaaaaat
ataattcgtattaagaataaagagtatgaattaggaagtgttgttgtagaaagtaatgga
aaggtttacgtaccagaagaagcaattcatctatttagaaaacattctcgttaa

DBGET integrated database retrieval system