KEGG   Bacillus anthracis A16R: A16R_40890Help
Entry
A16R_40890        CDS       T02999                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
banr  Bacillus anthracis A16R
Brite
KEGG Orthology (KO) [BR:banr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:banr03009]
    A16R_40890
Enzymes [BR:banr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     A16R_40890
Ribosome biogenesis [BR:banr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A16R_40890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 ThiS-like DUF3892 DUF4230
Motif
Other DBs
NCBI-ProteinID: AHE85430
Position
complement(3712167..3713075)
Genome map
AA seq 302 aa AA seqDB search
MSEVVQVTVAEEQKNERIDKFVAGINNEWSRTQVQQWIKDDVVTVNGKAVKGNYKVREND
EITVTIPEPEELDIQPEDMNLEIYYEDADVLVVNKPRGMVVHPAPGHTSGTLVNGLMHHC
TDLSGINGVMRPGIVHRIDKDTSGLLMVAKNDMAHESLVNQLVAKTVTRRYKAIVHGVIP
HDKGTIDAPIARDKKERQSMTVDENGKHAVTHFQVLERFKDFTLVECRLETGRTHQIRVH
MKYIGYPLAGDPKYGPKKTLDMNGQALHAGILGFDHPRTGEYIQFEAPIPEVFEDALNIL
RK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtagtacaagtaacagttgcagaagaacaaaaaaatgagcgaattgataaa
ttcgttgcaggaataaataatgaatggtcacgtacacaagtacagcaatggattaaagat
gacgttgtaacagttaatggaaaagcggtaaaagggaattataaagttagagaaaatgat
gaaattacagtgacgattcctgagccagaagagttagatattcaaccagaagatatgaat
ttagagatttattatgaagatgcagatgtactcgttgttaataagccgcgtggtatggtt
gtacatccagcaccaggtcatacaagtggaacgcttgtgaacggtcttatgcaccattgt
acagacttatcgggtattaacggtgtaatgcgtccaggtatcgtgcatcgtattgataag
gatacatcaggcctattaatggttgctaaaaatgatatggcacacgaatcacttgtaaat
caacttgtagcaaaaacagtaacaagacgttacaaagcgattgtacacggtgttattccg
catgataagggaacaattgatgctccgattgctcgtgataagaaagaacgtcaaagtatg
acggttgatgaaaatggtaagcatgctgttacgcatttccaagtgttagagcgattcaaa
gatttcacacttgtagaatgtcgcttagaaacagggcgtacacaccaaattcgtgttcat
atgaaatatattggctatccacttgcaggagatccaaagtatggaccaaagaaaacatta
gatatgaatggacaagcacttcacgcaggcattttaggatttgaccatcctcgtactggt
gaatatattcagtttgaggcaccgattccagaagtgtttgaagacgcattaaatatttta
cgaaaatag

DBGET integrated database retrieval system