KEGG   Bacillus anthracis A16R: A16R_45010Help
Entry
A16R_45010        CDS       T02999                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
banr  Bacillus anthracis A16R
Pathway
banr00260  Glycine, serine and threonine metabolism
banr00630  Glyoxylate and dicarboxylate metabolism
banr00670  One carbon pool by folate
banr01100  Metabolic pathways
banr01110  Biosynthesis of secondary metabolites
banr01130  Biosynthesis of antibiotics
banr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:banr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A16R_45010
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A16R_45010
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A16R_45010
Enzymes [BR:banr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     A16R_45010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AHE85842
Position
complement(4051519..4052619)
Genome map
AA seq 366 aa AA seqDB search
MITLQRTPLFDVYAKYGGKTIDFGGWELPVQFSSIKEEHEAVRTAAGLFDVSHMGEVEVK
GVDSLAFLQRVVTNDVSTLKVGGAQYTAMCYENGGTVDDLLIYKRGEEDYLLVINASNIE
KDYEWLASHVIGDATVVNVSSEVAQLAIQGPKAEGILQKVVSEDLKEIKFFKFKNDILVD
GIPALVSRTGYTGEDGFEIYCKSEDAAKLWEKLLEVGAEEGLKACGLGARDTLRFEATLP
LYGQELSKDITPIEAGIGFAVKTNKEADFFGKATLKEQKENGAPRKLVGIEVIERGIPRT
HYPVFIGEEKIGEVTSGTQSPTLKKSIGLALIDVKYAAVDTEVEIEIRNKRVKAVVVPTP
FYKRSK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgattacattacaacgtacaccgttatttgatgtatacgcgaagtatggtgggaaaaca
atcgacttcggtggttgggagttaccagttcaattttcaagcattaaagaagaacatgaa
gctgtacgtacagcggcgggtttgttcgatgtgtctcatatgggagaagttgaggtaaaa
ggtgtagatagtttagcatttttacaacgtgttgttacaaatgacgtatctaccttaaag
gtaggaggcgcacaatatacagcaatgtgctacgaaaatggtggtacagtagatgattta
ttaatctacaaacgtggtgaagaagactatttattagttatcaacgcatcaaatatcgag
aaagattacgaatggttagctagccatgtaattggcgatgcgacagtagtcaatgtttct
agcgaagttgcacagcttgcaattcaaggaccaaaagcagaaggcattttacaaaaagtt
gtgtcagaagatttaaaagaaattaagttctttaaatttaaaaacgatattcttgtagat
ggaattccagcacttgtatctcgtacaggttacacaggtgaagatggatttgaaatttac
tgtaagagtgaagatgcagcaaaactttgggagaaacttcttgaagttggagcagaagaa
ggcttaaaagcatgtggtttaggtgctcgtgatacacttcgcttcgaagcaacattacca
ctttatggtcaagaattatcaaaagatattacaccgattgaagctggaattggctttgcg
gtaaaaacaaataaagaagcagacttctttggaaaagcaacgttaaaagagcaaaaagaa
aacggtgcgcctcgcaaattagtcggcatcgaagtaattgaacgtggaattcctcgtacg
cattaccctgtatttattggagaagaaaagatcggggaagtaacaagtggtacacaatct
ccaacgttaaagaaaagcattggtttagcactaattgatgtaaaatacgcagcagttgat
acagaagtagaaattgaaattcgtaataaacgcgtcaaagcagtagttgttccaacacca
ttttataaacgttcaaagtaa

DBGET integrated database retrieval system