KEGG   Bacillus anthracis A16R: A16R_53560Help
Entry
A16R_53560        CDS       T02999                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
banr  Bacillus anthracis A16R
Pathway
banr00450  Selenocompound metabolism
banr00970  Aminoacyl-tRNA biosynthesis
banr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A16R_53560
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A16R_53560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:banr01007]
    A16R_53560
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:banr03016]
    A16R_53560
Enzymes [BR:banr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A16R_53560
Amino acid related enzymes [BR:banr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A16R_53560
Transfer RNA biogenesis [BR:banr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A16R_53560
 Prokaryotic type
   Other AARSs
    A16R_53560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: AHE86669
Position
complement(4783821..4785455)
Genome map
AA seq 544 aa AA seqDB search
MSIFIGGAWPYANGSLHLGHIASLLPGDILARYYRAKGENVLYVSGSDCNGTPIAIRAKQ
EGVTAKEIANKYHEEFERCFRNLGFTYDCYTRTDSEHHHETVQNVFLRLLEEGHIYKKTV
EQAYCETCTQFLPDCYVEGVCPHCHEEARGDQCDACSAILDPLDLLEKKCKLCGSTPSIQ
ETEHFYFALHTFQEQIKRAVEIAKQTGTWRDNAIQLTERYVKEGLLDRAVSRDLPIGVPI
PVEGYEDKKIYVWIEAVTGYYSASKHWAEETGKDDREFWDGEAKTYYVHGKDNIPFHSVI
WPAVLLGIGEGTIPRHIVSNEYLTVEKRKLSTSKNWAVWVPDILERYDPDSIRYFLIVNA
PENRDTDFSWREFIYSHNSELLGAYGNFVNRTLKFIEKYYGGIMPKGSIDVELKDKIERL
YKHVGEAIEQTKFKVALESIFDAVRFANKYFDERQPWKEREDDPVSCEETIYNCVYLIAN
FANLLEPFLPFSSERIRNTLSIVNRNWEPQHTLPSRIDSVQPLFERIDVKQIECELEKLY
GAVK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttattgggggcgcttggccgtatgcaaatggttcgttacatcttggacat
attgcgagtttgttacctggagatattttagcacgttattaccgggcaaaaggtgagaat
gtgttgtatgtttcggggagtgattgcaatggaacaccaattgcaattcgggcaaaacaa
gaaggtgtgacggcgaaggaaattgctaataagtatcatgaagagtttgagcgatgtttt
cgtaaccttggttttacgtatgattgctatacacgtacagatagtgagcaccatcatgaa
acggttcaaaatgtttttttacgtttattagaagaaggacatatttataaaaaaacagta
gaacaagcatattgcgaaacgtgtacacagtttttacctgattgttatgtagaaggtgtt
tgtccacattgccatgaagaggcaagaggagatcaatgcgatgcgtgttcagctatttta
gatccactcgatttgttagaaaagaaatgtaagttatgtggtagtacaccatccatacag
gaaacagagcatttctatttcgcattgcatacatttcaggagcaaattaaaagggctgta
gaaatcgctaaacaaacaggaacatggcgcgacaatgcgattcaactaacagagagatat
gtaaaggaaggattactagatagggccgtatcacgtgatttaccaatcggggtaccaatt
ccagtagaagggtatgaagataagaaaatttacgtatggattgaagcagtgacagggtat
tattcagcaagtaaacattgggctgaagaaacagggaaagatgatcgagagttttgggat
ggcgaagcgaaaacatattatgtgcacggaaaggataatattccgtttcattccgtcatt
tggccagcggtcttacttggaataggagaagggacaattcctcgtcatatcgtttcgaat
gaatatttaacagttgaaaaaagaaaattatctacgagtaaaaactgggcagtatgggtg
cctgatatattagaacgttatgatccagattctattcgttactttttaatagtaaatgca
ccagaaaatcgtgacactgacttttcatggcgtgaatttatttacagtcataatagtgaa
ttgttaggtgcatacgggaactttgtgaaccgaacattaaagtttattgaaaaatattat
ggtggtatcatgccgaagggaagtattgatgtagagctaaaagataagatagaaagatta
tataaacatgtaggagaggcgattgagcaaactaaatttaaggtggcattagaatcaata
tttgatgcagtacgttttgcaaataaatactttgatgagaggcagccatggaaagaaagg
gaagatgatccagtttcatgcgaagaaacgatttataattgtgtgtatctcatcgctaat
tttgcaaatctcctggaaccatttttaccattttcaagtgaaagaattagaaacacatta
tcgattgtgaaccgaaattgggagcctcaacatacgttgccaagtagaattgatagtgta
cagccactatttgaacgaatcgatgtaaaacaaattgagtgtgagttagaaaagctatat
ggagcggtaaagtga

DBGET integrated database retrieval system