KEGG   Bacillus anthracis A16R: A16R_56660Help
Entry
A16R_56660        CDS       T02999                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
banr  Bacillus anthracis A16R
Pathway
banr00071  Fatty acid degradation
banr00072  Synthesis and degradation of ketone bodies
banr00280  Valine, leucine and isoleucine degradation
banr00310  Lysine degradation
banr00362  Benzoate degradation
banr00380  Tryptophan metabolism
banr00620  Pyruvate metabolism
banr00630  Glyoxylate and dicarboxylate metabolism
banr00640  Propanoate metabolism
banr00650  Butanoate metabolism
banr00900  Terpenoid backbone biosynthesis
banr01100  Metabolic pathways
banr01110  Biosynthesis of secondary metabolites
banr01120  Microbial metabolism in diverse environments
banr01130  Biosynthesis of antibiotics
banr01200  Carbon metabolism
banr01212  Fatty acid metabolism
banr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:banr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A16R_56660
   00630 Glyoxylate and dicarboxylate metabolism
    A16R_56660
   00640 Propanoate metabolism
    A16R_56660
   00650 Butanoate metabolism
    A16R_56660
  Lipid metabolism
   00071 Fatty acid degradation
    A16R_56660
   00072 Synthesis and degradation of ketone bodies
    A16R_56660
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A16R_56660
   00310 Lysine degradation
    A16R_56660
   00380 Tryptophan metabolism
    A16R_56660
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A16R_56660
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A16R_56660
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A16R_56660
Enzymes [BR:banr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A16R_56660
Exosome [BR:banr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A16R_56660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHE86978
Position
complement(5073631..5074812)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVIDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHKEGRFEEEIVPVTIPQRKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKKIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccggtggggaaatttggaggatct
ttaaaagatgtaaaagcaacagaacttggaggaatcgcaattaaagcagcgcttgaaaga
gcgaatgtttcagctagtgatgttgaggaagttatattcggaacggttattcaaggtgga
cagggacaaattccatcacgccaagctgcaagggctgctggaatcccttgggaagtgcag
acggaaactgtcaataaagtttgtgcatcagggcttcgtgcggtgactttagcggatcaa
attattcgtactggcgatcaatcactaattgtagctggtggtatggagtcgatgagtaac
agtccttacattttacgaggagcaagatggggatacagaatgggtaacaacgaagtcatt
gatttaaacgttgctgacggtttaacatgcgcattttcaggtatacacatgggtgtttat
ggcggagaagttgcgaaggaggatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccatcagcgtgcagtttcagcgcataaagaaggacgttttgaagaggaaatcgtg
ccagtaacgattccacaaagaaaaggcgatcctattgtcgttgcaaaggatgaggcgccg
cgtgaagatacaacaattgaaaaactagcaaaattaaaacctgtatttgataagacagcg
acggtgacagctggtaatgcaccagggctaaacgatggtggcgctgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagatttcccgaggacgccaggttatgcaattaacgcattg
cttgaaaaaacaggaaagaaaattgaagacatcgatttatttgagattaatgaagcattt
gcagcggtagcaattgcaagtacagaaatcgcaggaattgacccagaaaaattgaatgta
aatggcggcgcagtggcgatgggacatccgattggagcaagcggagcgcgcattatcgtt
acactaatccatgcacttaagcaacgcggcggtggaattggaattgcttcgatttgtagt
ggtggcggtcaaggcgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system