KEGG   Bacillus anthracis SVA11: BAPAT_3035Help
Entry
BAPAT_3035        CDS       T03162                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
bans  Bacillus anthracis SVA11
Pathway
bans00230  Purine metabolism
bans00240  Pyrimidine metabolism
bans00760  Nicotinate and nicotinamide metabolism
bans01100  Metabolic pathways
bans01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bans00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BAPAT_3035
   00240 Pyrimidine metabolism
    BAPAT_3035
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BAPAT_3035
Enzymes [BR:bans01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BAPAT_3035
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     BAPAT_3035
CD molecules [BR:bans04090]
 Proteins
  BAPAT_3035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AHK39179
Position
complement(2894076..2895665)
Genome map
AA seq 529 aa AA seqDB search
MLKKIIPVALALSTVIFTSVFAVPSAQASTEPNRYIDVQMLGINDFHGQLDTVKKINNKD
AGGIEYLGAYLRDREKQNPNTLKVHAGDVVGASTPVSALLQDEPTIEFLNDLKFDVGTIG
NHEFDEGVEEMNRLIYGGYHEKTGKFKGAKFPYVAANFYNKSTGRLFLPPFTIKKVQGVP
VGFIGVVTTDVPNLVMPTMLKNVEITDEVEAINKSVKQLKKLGVKSIVVLAHNGGTTDGN
GVTNGDIVRLANETDPEVDVIFGGHSHTYVNGTVNNKLVVQANSYGMAFADVDVKIDRKT
QDIVEKKAEIVTTYHEGMEPDKKIKKKMEKYQAKIAPLVNEVVGKSIAPLDRKLNTAGES
TLGNLVADAQRATMQSQIALMNPGGIRNDLDAGDITWGEIYGIQPFGNQLIKVNLTGQDI
RDILNQQWQKDITRMLQISGIQYTWDANKPNGEKVTSIRLTNGEEIIPSKTYSVVANAFL
ASGGDGFVSFKNGKDAETGPTDFEALVDYIKKSKEPIQSIIDGRIQKIN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaaatcattccagttgctttagcattaagtacagttatttttactagtgta
ttcgctgtgccttcagcccaagcaagtacagaaccaaaccgctacatagatgtacaaatg
ctcggtattaacgattttcacgggcaactagacacagtaaaaaaaattaacaataaagat
gcagggggaatcgagtacttaggggcttatttacgtgatcgtgaaaaacaaaatccgaat
acattaaaagtacatgctggcgatgttgttggagcaagtactcctgtttcagcattatta
caagacgaacctactattgaatttctaaatgatttgaaattcgatgttggaactatagga
aatcatgaatttgatgaaggtgttgaagaaatgaaccgccttatttatggtggataccat
gagaaaacagggaaatttaaaggtgcaaaattcccatatgttgccgcaaatttctataat
aaatctactggtcgtttatttttaccaccattcactataaaaaaggtacaaggagttcct
gttggatttatcggagtcgtaacaacggatgtgcctaaccttgttatgcctactatgcta
aagaatgtagaaattacagatgaagttgaagctattaacaaatccgtaaagcaattaaaa
aaactaggtgttaaatctatcgttgttcttgcacataacggtgggacaacagatgggaac
ggcgtaacaaatggtgatatcgtccgattagcaaatgagactgatccagaagtcgatgtt
atttttggtgggcatagccacacttatgtaaatggaactgttaataataaacttgtcgta
caagcaaattcttacggtatggcttttgctgatgttgatgtaaagattgatcgtaaaaca
caagatattgttgagaaaaaagcagaaattgttacaacttaccatgaaggcatggagcct
gataaaaaaataaagaagaagatggagaaatatcaagcaaaaatcgcacctcttgttaat
gaagttgtaggtaagtctattgctccgctagatcgcaaactaaatacggctggtgaatct
actcttggaaatttagttgctgatgcccagcgtgcaacaatgcaatctcaaattgcactt
atgaatcctggtggtattcgtaatgacttagatgctggtgatattacatggggagagata
tatggtattcaaccattcggaaatcaattaataaaagtaaatttaacgggtcaagatatt
cgtgatattttaaatcaacaatggcaaaaagacataacaagaatgcttcaaatttcaggg
atccaatacacttgggatgcaaacaaacctaatggagaaaaagtaacaagtattcgccta
acaaatggagaagaaattattccttctaaaacttacagcgtcgttgcgaacgcatttcta
gcttcaggtggagatggatttgtatcctttaaaaacggtaaagatgctgaaacaggacca
actgattttgaagcattagtagattacataaaaaaatcaaaagaaccaattcagtctatt
attgatggaagaattcaaaaaataaattag

DBGET integrated database retrieval system