KEGG   Bacillus anthracis SVA11: BAPAT_3528Help
Entry
BAPAT_3528        CDS       T03162                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bans  Bacillus anthracis SVA11
Pathway
bans00071  Fatty acid degradation
bans00072  Synthesis and degradation of ketone bodies
bans00280  Valine, leucine and isoleucine degradation
bans00310  Lysine degradation
bans00362  Benzoate degradation
bans00380  Tryptophan metabolism
bans00620  Pyruvate metabolism
bans00630  Glyoxylate and dicarboxylate metabolism
bans00640  Propanoate metabolism
bans00650  Butanoate metabolism
bans00900  Terpenoid backbone biosynthesis
bans01100  Metabolic pathways
bans01110  Biosynthesis of secondary metabolites
bans01120  Microbial metabolism in diverse environments
bans01130  Biosynthesis of antibiotics
bans01200  Carbon metabolism
bans01212  Fatty acid metabolism
bans02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAPAT_3528
   00630 Glyoxylate and dicarboxylate metabolism
    BAPAT_3528
   00640 Propanoate metabolism
    BAPAT_3528
   00650 Butanoate metabolism
    BAPAT_3528
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAPAT_3528
   00072 Synthesis and degradation of ketone bodies
    BAPAT_3528
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAPAT_3528
   00310 Lysine degradation
    BAPAT_3528
   00380 Tryptophan metabolism
    BAPAT_3528
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAPAT_3528
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAPAT_3528
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAPAT_3528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bans04147]
    BAPAT_3528
Enzymes [BR:bans01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAPAT_3528
Exosome [BR:bans04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAPAT_3528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHK39666
Position
complement(3371536..3372627)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGMERAIDDVILGNVVGPGGNV
ARLSALEAGLGHHIPGVTIDRQCGAGLEAIRTACHFIQGGGGKCYIAGGVESTSTSPFQN
RARFSPETIGDPNMGVAAEYVAESYNITREMQDEYACLSYKRTLQALAKGYIHEEILSFN
GLLDESIKPEMNYERIIKRTKPAFLHNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPNLPGTGPIFAVNKLLNERNMKVEDIDYFEINEAFASKVVACAKELQ
IPFGKLNVNGGAIALGHPYGASGAMLVTRLFYQAKRERMKYGIATLGIGGGVGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaagcgaaaaggacacctattggtaagaagaatgggatg
ttaaaagactatgaagttcagcaattagcagcaccgcttcttacatttttaagtaaagga
atggagagagcgatagacgatgtcatattagggaatgttgttgggccaggagggaatgtt
gcgagattatctgctttagaagcagggcttggtcatcatattccgggtgtaacgattgac
cgacaatgtggtgccggattggaagcgattcgcaccgcatgtcatttcattcaaggcggg
ggcggtaagtgttatatcgccggaggagtagagagtacaagtacgtcaccttttcaaaat
agggcgcgattttcaccagaaacaattggcgatcctaatatgggagtagcggctgagtat
gttgcagaaagttataacatcacgagagaaatgcaagacgagtatgcatgcctcagttat
aaacgaacactgcaagcattagcaaaaggatatatacatgaggaaatattgtcttttaat
ggattgctagatgaatccattaagccagaaatgaattatgaacgaatcattaaaagaaca
aaacctgcatttttacacaatggtacagtaacggcaggtaattcgtgcggtgtaaatgat
ggagcatgtgccgttcttgtaatggaagagggacaagcccgaaaattaggatacaagcct
gtacttcgtttcgttcgtagtgctgtagttggagtggatcctaaccttccggggactggt
ccgatatttgcggtgaacaaattattaaacgaaaggaatatgaaagtagaggacatcgat
tattttgaaataaatgaagcatttgcctcaaaagttgtagcttgtgcaaaggagttacaa
attcctttcggaaaattaaatgtaaatggtggggcaattgcgcttggtcatccgtacggt
gcatctggggctatgcttgtaacgcgcttgttttatcaggcgaaacgagagcgtatgaaa
tatggaatcgcaacgttaggaatagggggcggggtaggtcttgcactattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system