KEGG   Bacillus anthracis SVA11: BAPAT_4380Help
Entry
BAPAT_4380        CDS       T03162                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bans  Bacillus anthracis SVA11
Pathway
bans00564  Glycerophospholipid metabolism
bans01100  Metabolic pathways
bans01110  Biosynthesis of secondary metabolites
Module
bans_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bans00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAPAT_4380
Enzymes [BR:bans01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BAPAT_4380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AHK40508
Position
complement(4131988..4132752)
Genome map
AA seq 254 aa AA seqDB search
MIELTNGRFTSYTLRKFAQSRLSSIIIPSYAKVFQINQDEMEKGLKEYRTLHELFTRKLK
EGKRSIDTDASSIVSPVDGVFADHGPIEDTKTFDIKGKRYSIVDMLGNEERAQRYAGGTY
MVIYLSPSHYHRIHSPLSGSVTERFVLGRKSYPVNAAGMEYGKEPLSKNYRSVTEVNSDG
EHMALVKVGAMFVNSIELLHERDTVQKGEEMAYFTFGSTVVLLFEKDMIEVVQELKSGQE
LRLGEKIATRLAHK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacttacaaatggtcgttttacttcttatacattacgtaaatttgcacaatct
cgtttgagctctatcattattccatcgtatgcgaaagtgtttcaaattaatcaagatgag
atggaaaagggtttgaaggaatatagaacattgcatgaattatttacacgtaagctaaaa
gaaggaaagcgtagtattgatacagatgcatcgagtatcgttagtcctgttgatggtgtt
tttgctgatcacggtcctattgaggacacaaaaacatttgatattaaaggaaagcgttat
tcgattgtggatatgctaggtaatgaagaacgtgcacagcgatatgcaggtggtacatat
atggttatttatttaagcccaagtcattatcatcgtattcatagtccgctttctggttct
gtgactgaaagatttgtactcggtagaaaatcatatccggtaaatgcagctggtatggaa
tacgggaaagaaccattgtcaaaaaactatcgctccgttacagaagtgaatagtgacggt
gaacatatggcgcttgtaaaagtaggagctatgtttgtaaatagtattgagctgctgcat
gaaagagacactgttcaaaaaggtgaagaaatggcatactttacattcggttcaacagtt
gtgttattgtttgaaaaagatatgatagaagtagtgcaagaattgaagagtggacaagag
cttcgccttggtgaaaaaattgctactcgattggctcataagtaa

DBGET integrated database retrieval system