KEGG   Bacillus anthracis A16: A16_45840Help
Entry
A16_45840         CDS       T02998                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bant  Bacillus anthracis A16
Pathway
bant00790  Folate biosynthesis
bant01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bant00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A16_45840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bant04147]
    A16_45840
Enzymes [BR:bant01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     A16_45840
Exosome [BR:bant04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A16_45840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a FBA
Motif
Other DBs
NCBI-ProteinID: AHE91844
Position
4169223..4169537
Genome map
AA seq 104 aa AA seqDB search
MMLRLTEEEVQEELLKLDKWVVKDEKWIERKYMFSDYLKGVEFVSEAAKLSEEHNHHPFI
LIQYKAVIITLSSWNAKGLTKLDFELAKQFDELFVQNEKAVIRK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacgattaactgaagaagaagttcaagaggaattattaaagttagataaatgg
gtagtaaaagatgaaaaatggattgaaagaaaatatatgttttccgactacttaaaagga
gtcgaatttgtctctgaagccgccaaactatcagaagaacataatcaccacccatttatc
cttatccagtataaagcagtcattattactttgtcatcttggaatgcaaaaggtttaacg
aaactcgattttgagcttgcgaagcaatttgatgaactatttgtccaaaatgaaaaagcc
gttataagaaagtaa

DBGET integrated database retrieval system