KEGG   Bacillus anthracis A16: A16_55980Help
Entry
A16_55980         CDS       T02998                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bant  Bacillus anthracis A16
Pathway
bant00071  Fatty acid degradation
bant00072  Synthesis and degradation of ketone bodies
bant00280  Valine, leucine and isoleucine degradation
bant00310  Lysine degradation
bant00362  Benzoate degradation
bant00380  Tryptophan metabolism
bant00620  Pyruvate metabolism
bant00630  Glyoxylate and dicarboxylate metabolism
bant00640  Propanoate metabolism
bant00650  Butanoate metabolism
bant00900  Terpenoid backbone biosynthesis
bant01100  Metabolic pathways
bant01110  Biosynthesis of secondary metabolites
bant01120  Microbial metabolism in diverse environments
bant01130  Biosynthesis of antibiotics
bant01200  Carbon metabolism
bant01212  Fatty acid metabolism
bant02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A16_55980
   00630 Glyoxylate and dicarboxylate metabolism
    A16_55980
   00640 Propanoate metabolism
    A16_55980
   00650 Butanoate metabolism
    A16_55980
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A16_55980
   00072 Synthesis and degradation of ketone bodies
    A16_55980
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A16_55980
   00310 Lysine degradation
    A16_55980
   00380 Tryptophan metabolism
    A16_55980
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A16_55980
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A16_55980
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A16_55980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bant04147]
    A16_55980
Enzymes [BR:bant01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A16_55980
Exosome [BR:bant04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A16_55980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHE92830
Position
complement(5073646..5074827)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVIDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHKEGRFEEEIVPVTIPQRKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKKIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccggtggggaaatttggaggatct
ttaaaagatgtaaaagcaacagaacttggaggaatcgcaattaaagcagcgcttgaaaga
gcgaatgtttcagctagtgatgttgaggaagttatattcggaacggttattcaaggtgga
cagggacaaattccatcacgccaagctgcaagggctgctggaatcccttgggaagtgcag
acggaaactgtcaataaagtttgtgcatcagggcttcgtgcggtgactttagcggatcaa
attattcgtactggcgatcaatcactaattgtagctggtggtatggagtcgatgagtaac
agtccttacattttacgaggagcaagatggggatacagaatgggtaacaacgaagtcatt
gatttaaacgttgctgacggtttaacatgcgcattttcaggtatacacatgggtgtttat
ggcggagaagttgcgaaggaggatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccatcagcgtgcagtttcagcgcataaagaaggacgttttgaagaggaaatcgtg
ccagtaacgattccacaaagaaaaggcgatcctattgtcgttgcaaaggatgaggcgccg
cgtgaagatacaacaattgaaaaactagcaaaattaaaacctgtatttgataagacagcg
acggtgacagctggtaatgcaccagggctaaacgatggtggcgctgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagatttcccgaggacgccaggttatgcaattaacgcattg
cttgaaaaaacaggaaagaaaattgaagacatcgatttatttgagattaatgaagcattt
gcagcggtagcaattgcaagtacagaaatcgcaggaattgacccagaaaaattgaatgta
aatggcggcgcagtggcgatgggacatccgattggagcaagcggagcgcgcattatcgtt
acactaatccatgcacttaagcaacgcggcggtggaattggaattgcttcgatttgtagt
ggtggcggtcaaggcgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system