KEGG   Bacillus anthracis Vollum: DJ46_1394Help
Entry
DJ46_1394         CDS       T03475                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
banv  Bacillus anthracis Vollum
Pathway
banv00730  Thiamine metabolism
banv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DJ46_1394 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:banv03000]
    DJ46_1394 (tenA)
Enzymes [BR:banv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     DJ46_1394 (tenA)
Transcription factors [BR:banv03000]
 Prokaryotic type
  Other transcription factors
   Others
    DJ46_1394 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 TPR_MLP1_2 Paramyxo_C
Motif
Other DBs
NCBI-ProteinID: AIK66261
Position
1306694..1307383
Genome map
AA seq 229 aa AA seqDB search
MTFSQSLRKEVDSIWEASFHHPFVKKLGEGTLDLANFRYYVLQDSYYLSHFARVQTLGAA
KALELETTARMAHHAQNTYEAELSLHENFAKKLGITQEEKDNFIPAPTAYAYTSHMYRAA
YEGHLGDIIAAILPCYWLYYEIGERLKECQPEEPIYNEWISAYGSDWFRTLVEEQITRLD
AIAEKVTESDRKRMKQHFVISSQYEYSFWEMAYTLEKWPVDTEVKDVIR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgactttttcacaatcattacgtaaagaagtagattcaatttgggaagctagttttcat
catccttttgtaaaaaaactcggtgaaggaacgttagatttagctaattttcgctattac
gtgcttcaagattcctattatttgagtcactttgctagagtacaaacattaggagctgca
aaagcgcttgaattagaaacgactgctcgcatggcacatcatgctcaaaatacatatgag
gcggaattatctttacatgagaactttgcgaagaaactagggattacacaagaagaaaaa
gataattttatccctgctccaactgcatatgcatatacttcacatatgtaccgtgctgcg
tatgaaggacatttaggcgatattattgcagcaattttaccttgctattggctgtattat
gaaattggtgagcgtttaaaagagtgtcagccagaagagccgatttataacgaatggatt
tctgcttatggatctgattggttccgaacattagttgaagagcaaattacacgattagat
gcaatagctgaaaaagtgacagagtctgatcgtaagcgtatgaaacagcattttgttata
agtagtcaatatgaatattcattttgggaaatggcttatactttagaaaagtggccggta
gatacagaagtaaaagatgtaataagataa

DBGET integrated database retrieval system