KEGG   Bacillus anthracis Vollum: DJ46_2933Help
Entry
DJ46_2933         CDS       T03475                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
banv  Bacillus anthracis Vollum
Pathway
banv00071  Fatty acid degradation
banv00072  Synthesis and degradation of ketone bodies
banv00280  Valine, leucine and isoleucine degradation
banv00310  Lysine degradation
banv00362  Benzoate degradation
banv00380  Tryptophan metabolism
banv00620  Pyruvate metabolism
banv00630  Glyoxylate and dicarboxylate metabolism
banv00640  Propanoate metabolism
banv00650  Butanoate metabolism
banv00900  Terpenoid backbone biosynthesis
banv01100  Metabolic pathways
banv01110  Biosynthesis of secondary metabolites
banv01120  Microbial metabolism in diverse environments
banv01130  Biosynthesis of antibiotics
banv01200  Carbon metabolism
banv01212  Fatty acid metabolism
banv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:banv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DJ46_2933 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    DJ46_2933 (thlA)
   00640 Propanoate metabolism
    DJ46_2933 (thlA)
   00650 Butanoate metabolism
    DJ46_2933 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DJ46_2933 (thlA)
   00072 Synthesis and degradation of ketone bodies
    DJ46_2933 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DJ46_2933 (thlA)
   00310 Lysine degradation
    DJ46_2933 (thlA)
   00380 Tryptophan metabolism
    DJ46_2933 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DJ46_2933 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DJ46_2933 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DJ46_2933 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:banv04147]
    DJ46_2933 (thlA)
Enzymes [BR:banv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DJ46_2933 (thlA)
Exosome [BR:banv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DJ46_2933 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIK65424
Structure
PDB: 

Position
complement(2754350..2755525)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatggggattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaatggt
agtggtgtaggacttggacatccaattggttgtacaggagctcgtattactgtaagttta
attcatgaattaaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggagtagcattatttatagaagcactataa

DBGET integrated database retrieval system